KEGG   Oryctolagus cuniculus (rabbit): 100009349
Entry
100009349         CDS       T03373                                 
Symbol
BMP2, BMP-2
Name
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu05200  Pathways in cancer
ocu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100009349 (BMP2)
   04390 Hippo signaling pathway
    100009349 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009349 (BMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009349 (BMP2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100009349 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009349 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009349 (BMP2)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100009349 (BMP2)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100009349 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100009349
NCBI-ProteinID: NP_001076119
Ensembl: ENSOCUG00000011674
UniProt: O46564
LinkDB
Position
4:complement(29448574..29450293)
AA seq 395 aa
MVAGTRCLLALLLPQVLLGGAAGLIPELGRRKFAASSGRPSPQPSDDILSEFELRLLSMF
GLKQRPTPSRDAVVPPYMLDLYRRHSGQPGAPAPDHRLERAASRANTVRSFHHEESLEEL
PETSGKTTRRFFFNLTSIPPEEFITSAELQVFREQMQEALGDDSGFHHRINIYEIIKPAT
ANSKFPATRLLDTRLVNQNTSRWESFDVTPAVMRWTAQGHANHGFVVEVTHLEEKQGVSK
RHVRISRSLHPDEHSWSQIRPLLVTFGHDGKGHPLHRREKRQAKHKQRKRLKSSCKRHPL
YVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACC
VPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcatccccgagctgggccgcaggaagttcgcggcgtcatcgggccgcccc
tcgccccagccctcggacgacatcctgagcgagttcgagttgcggttgctcagcatgttc
ggtctgaagcagagacccacccctagcagggacgccgtggtgcccccctacatgctggac
ttgtaccgccggcactccggccagcctggcgcgcccgccccggaccaccggctggagagg
gcagccagccgcgccaacacggtgcgcagcttccaccacgaagaatcgttggaagaactg
ccagaaacaagtgggaaaaccacccggcgattcttctttaatttaacttccattcccccg
gaggagtttatcacctctgcagaacttcaggtttttcgagaacagatgcaggaagctttg
ggagacgacagcggtttccatcatagaattaatatttatgaaattataaagcctgcaaca
gccaactcgaaattccccgccaccagactgctggacaccaggttggtgaatcagaacacg
agccggtgggagagcttcgacgtcacccctgccgtgatgcggtggactgcacagggacac
gccaaccatgggtttgtggtggaagtgacccacttggaggagaagcaaggtgtctccaag
agacacgtgaggattagcaggtctttgcacccagatgaacacagctggtcacaaatcagg
cctttgctcgtaacttttggtcacgatgggaaggggcaccccctgcacagaagagaaaag
cgtcaagcgaaacacaaacagcggaaacgcctcaaatccagctgtaagagacaccctttg
tacgtggacttcagcgacgtggggtggaacgactggattgtggcccctccggggtatcac
gccttttactgccatggggagtgcccctttcccctggctgatcacctgaactccactaac
catgccatcgtgcagactttggtcaactccgtgaactctaagattccgaaggcatgctgt
gtcccaacagaactcagtgctatctccatgctgtaccttgatgagaatgaaaaggttgta
ttaaagaactatcaggacatggttgtggagggttgtgggtgtcgttag

KEGG   Oryctolagus cuniculus (rabbit): 108175367
Entry
108175367         CDS       T03373                                 
Name
(RefSeq) bone morphogenetic protein 2-like
  KO
K21283  bone morphogenetic protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu05200  Pathways in cancer
ocu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    108175367
   04390 Hippo signaling pathway
    108175367
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108175367
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    108175367
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    108175367
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    108175367
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    108175367
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   108175367
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   108175367
SSDB
Motif
Pfam: TGFb_propeptide
Other DBs
NCBI-GeneID: 108175367
NCBI-ProteinID: XP_017197258
LinkDB
Position
4:13207823..13209750
AA seq 147 aa
MVAGTRCLLALLLPQVLLGGAAGLIPELGRRKFAASSGRPSPQPSDDILSEFELRLLSMF
GLKQRPTPSRDAVVPPYMLDLYRRHSGQPGAPAPDHRLERAASRANTVRSFHHEESLEEL
PETSGKTTRRFFFNLTSIPPEEFITSA
NT seq 440 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcatccccgagctgggccgcaggaagttcgcggcgtcatcgggccgcccc
tcgccccagccctcggacgacatcctgagcgagttcgagttgcggttgctcagcatgttc
ggtctgaagcagagacccacccctagcagggacgccgtggtgcccccctacatgctggac
ttgtaccgccggcactccggccagcctggcgcgcccgccccggaccaccggctggagagg
gcagccagccgcgccaacacggtgcgcagcttccaccacgaagaatcgttggaagaactg
ccagaaacaagtgggaaaaccacccggcgattcttctttaatttaacttccattcccccg
gaggagtttatcacctctgc

DBGET integrated database retrieval system