KEGG   Oryctolagus cuniculus (rabbit): 100009418
Entry
100009418         CDS       T03373                                 
Symbol
NEDD4
Name
(RefSeq) neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase
  KO
K10591  E3 ubiquitin-protein ligase NEDD4 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04144  Endocytosis
ocu04530  Tight junction
ocu05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100009418 (NEDD4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100009418 (NEDD4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100009418 (NEDD4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100009418 (NEDD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100009418 (NEDD4)
   04121 Ubiquitin system [BR:ocu04121]
    100009418 (NEDD4)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100009418 (NEDD4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100009418 (NEDD4)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100009418 (NEDD4)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100009418 (NEDD4)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    100009418 (NEDD4)
SSDB
Motif
Pfam: HECT WW
Other DBs
NCBI-GeneID: 100009418
NCBI-ProteinID: XP_008267188
Ensembl: ENSOCUG00000006856
UniProt: G1SRV2
LinkDB
Position
17:16607914..16739264
AA seq 1315 aa
MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKKPTRISASNVVQMKLTPRQTALAP
LIKESVKAQERSSVPASENVNKKSSCLQISLQPTRYSGCLPSCSVLADGDDVSSFARVLK
DDIDSSAVVDNELSAVSDGSLLSSSAICSGSLSNFSVSDNGSYSSTGSDYGSCASITSGG
SYTNSVISDSSGYTFPSSDDTFFGGNLYSDSTSNRSVPNRNTTPCESFSRSTSTVPFVQD
DLEPGIEIMKLPLSRNPKIPLKRCSSLVIFPRSPSSTPPASPTTTGTLPSKGSYQTSHQL
LVSPSEIAHNEDGTISKGFLSTAVNGLRLSKTICTAGEVRDIRSLHGKGSLQKKIVLSNN
SPKQTACEKSPEGYSCLSVHFTQHKVTTVDGKTTSGHCKPEKSGVKLNSDSECSKLVHKT
SACLPSSQNVDYQVNVSGELERPNSQINKSHAILQRSISLGGTYPNIACLSSLKHNCSKG
GPSQLLIKFASGNEGEVDSRDVTSELSNSCKTRDDFLGQVDVPLYPLPTENPRMERPYTF
KDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAACHLQQ
QQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDSLTDAENGDMQLQAQRAFTT
RRQISEETESPENRDSSENWEIIREDEAAVCGSQAFLSPAPSRSADVQTHLADELNARLA
VSGNSATSQPGSSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYY
VDHNSRTTTWTKPAVQATVETSQPSSSQSSPAGPQAQVPPGDSAQQVPQLAEVEQGFLPK
GWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKAPLDSSSDLGPLPPGWEERTHT
DGRIFYINHNIKKTQWEDPRLQNAAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPNKFEM
KLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMFNPYY
GLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFYKMML
HKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSEIVVT
NKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLGDVDV
NDWREHTKYKNGYSSSHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAELYGSN
GPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
NT seq 3948 nt   +upstreamnt  +downstreamnt
atggcacaaagcttacgattgcactttgcagccagaagaagtaatacttaccctttgtca
gagacctccggagatgatttggatagccatgtccacatgtgcttcaaaaaaccaacacgg
atttcagcgtctaacgtggtgcaaatgaagctgactcccagacagactgccctagctcca
ttaataaaggaaagcgttaaggctcaggaaagatcatctgttcctgcatctgaaaatgtt
aataaaaagagcagctgtctacagatttcgctgcagccaacaaggtacagtggatgtctt
ccgtcttgcagtgtcttggctgatggtgatgatgtgtcttcgtttgctcgtgtcttgaag
gatgacattgacagcagtgctgtggttgataatgaactaagtgctgtgagtgatggcagc
cttttgagcagttctgccatttgcagtggtagcctcagtaacttttcagtcagtgataat
ggatcttacagcagcaccggtagtgattatgggtcatgtgcgagtatcacaagtggaggg
tcgtacacgaacagtgtcatcagcgacagtagtggttatacttttccctcaagcgatgat
actttttttggtggaaatttatattctgacagcacctccaacagaagtgtgccaaacagg
aatactactccctgtgaaagtttttcaagaagtacaagtactgttccttttgtccaggat
gacttggagcctggaatagagattatgaaattgccattgagcaggaacccgaaaattcca
ctcaagcgctgctcatccttagtgatttttcctaggagtccttcaagtaccccaccagct
tctccaacaaccacaggtactcttccaagcaaaggctcctatcaaacttctcaccagttg
ctcgtgtctcctagtgaaattgcacataatgaagatggtactatttctaagggatttctt
tccacagccgtcaatggacttcggttatctaaaacaatttgcactgctggagaagtgaga
gacatccggtcgcttcatgggaagggctcattgcagaagaaaattgtcctttcaaataat
agtccgaaacagactgcctgtgagaagtcgcctgaaggatattcttgcctttcagtgcat
ttcacccaacacaaggtgaccacagtagatggcaaaactacgagtggtcattgtaaacca
gagaagtcgggagttaagcttaattccgattcagaatgtagcaagcttgtgcacaagaca
tctgcatgtttgccatcctcccaaaatgtagattaccaagtaaatgtcagtggagagttg
gaaagaccaaattcacagataaacaaaagccatgccattttacaaaggagtatttcattg
ggaggaacttatccaaatattgcctgtttatccagccttaagcacaattgttctaagggg
ggaccatctcaattactcataaagtttgcatctggaaatgaaggtgaagttgacagtaga
gatgtcacaagtgaactgtctaattcttgtaagacaagagatgatttcctaggtcaagtg
gatgttcctctttatccattaccgacagaaaatcccagaatggagagaccatatacattt
aaggattttgttcttcatccaagaagtcacaaatcaagagttaaaggttatctgagatta
aaaatgacttacttacctaaaaccagtggctcagaagatgataacgcagaacaggctgag
gaattagagcctggctgggttgttttggaccaaccagatgctgcttgccatttgcaacag
caacaggagccttcccctctgcctccaggatgggaagagaggcaggatatcctgggaagg
acctactatgtaaaccatgaatctagaaggacacagtggaagcgaccaacccctcaggac
agcctaacagatgctgagaatggtgacatgcagctgcaagcccagcgtgcgttcaccacc
aggaggcagatatccgaggaaacagaaagtcctgagaaccgagactcttccgagaactgg
gaaattataagagaggatgaagccgccgtgtgtggcagtcaggccttcctgtcacctgca
ccatccaggagcgcggatgttcagactcatcttgcggacgaactgaatgccagacttgct
gtctctggaaattcagccactagccagccgggatccagctcaaatcattccagcagaaga
ggcagcttacaagcctacacttttgaggaacagcctacgcttcctgtgcttttgcctact
tcatctggactaccaccaggttgggaagaaaaacaagacgaaagaggacgatcatactac
gtagatcacaattccaggacaacaacctggacaaagcctgctgtacaggccacagtggag
accagtcagccgtcatcaagccagagctcgcccgccggcccccaggcgcaggtgcctccc
ggagactcggcacagcaggtgccccagctggcggaagtggagcaaggattcctccccaag
ggctgggaagtccggcacgcgcccaacgggaggccgttctttattgaccacaacaccaaa
accaccacctgggaagatccaagattgaaaattccagctcatctgcgaggaaaggcacca
cttgattcatccagcgatctggggcctttacctccaggatgggaagagaggactcacaca
gatggaagaatattctacataaatcacaatattaaaaaaacacaatgggaagaccctcgg
ttgcagaatgcagccatcaccggaccagcagtgccctactccagggattacaaaagaaag
tatgagttcttccgaagaaagttgaagaagcagaatgacattccaaacaagtttgagatg
aagctccgccgggccaccgtgctcgaggactcctaccggagaatcatgggcgtcaagcga
gcagacttcctcaaggcccggctctggattgagttcgacggtgaaaaggggttagattat
ggaggcgtcgccagagaatggttcttcctgatctcaaaggaaatgtttaacccttactat
gggctgtttgaatattctgctacggacaattacaccttacagataaatccaaactctggg
ttgtgtaatgaagatcacctctcttacttcaagttcattggccgagtggctgggatggca
gtgtatcacggcaagctgttggatggttttttcattcgcccattttacaagatgatgcta
cacaaaccgatcacacttcatgatatggagtcagtggatagtgaatattacaactcacta
agatggattcttgaaaatgacccaacagaactggacctcaggtttatcatagatgaagaa
ctttttggacagacacatcaacatgagttgaaaaatggtggatcagaaatagttgtcacc
aataagaacaaaaaggaatatatttatcttgtaatacaatggcggtttgtaaaccgaatc
cagaagcaaatggctgcatttaaagagggattttttgaactgataccacaggatctcatt
aaaattttcgatgaaaatgaactagagcttcttatgtgcggcctgggagacgtggatgtg
aatgactggagagaacatacgaagtataaaaatggctacagcagcagtcatcaagtgata
cagtggttttggaaggctgttttaatgatggattcggagaaaagaataagattacttcag
tttgttactggcacatcccgtgtgcctatgaatggatttgctgaactatatggctcaaat
ggaccacagtcgttcacagttgaacagtggggtacccccgaaaaattgccaagggctcat
acctgctttaatcgcttggatttgccaccctatgagtcctttgaagaattatgggataag
cttcagatggccattgaaaacactcagggttttgatggagttgattag

KEGG   Oryctolagus cuniculus (rabbit): 100353099
Entry
100353099         CDS       T03373                                 
Symbol
NEDD4L
Name
(RefSeq) neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
  KO
K13305  E3 ubiquitin-protein ligase NEDD4-like [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04144  Endocytosis
ocu04530  Tight junction
ocu04960  Aldosterone-regulated sodium reabsorption
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100353099 (NEDD4L)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100353099 (NEDD4L)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100353099 (NEDD4L)
 09150 Organismal Systems
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100353099 (NEDD4L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100353099 (NEDD4L)
   04121 Ubiquitin system [BR:ocu04121]
    100353099 (NEDD4L)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100353099 (NEDD4L)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100353099 (NEDD4L)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100353099 (NEDD4L)
SSDB
Motif
Pfam: HECT WW
Other DBs
NCBI-GeneID: 100353099
NCBI-ProteinID: XP_002713659
Ensembl: ENSOCUG00000014471
LinkDB
Position
9:98656326..98875068
AA seq 835 aa
MERPYTFKDFLLRPRSHKSRVKGFLRLKMAYMPKNGAQDEENSEPRDDMEHGWEVVDSND
SASQHQEELPPPPLPPGWEEKVDNLGRTYYVNHNNRTTQWHRPSLMDVSSESDSNIRQIN
QEAAHRRFRSRRHISEDLEPEPSEGGEAPEPWETISEEVNLAGDSLGLAVPPPPASPVSR
TSPQELTEELSRRLQVTPDANGEQFSSLIQREPSSRLRSCSVTDAVAEQAHLPPPSVAYV
HTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQLAEDGAASGSATNSSNHLIEPQ
IRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHRVTQSFLP
PGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKASLNPNDLGPLPPGWEERIHL
DGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEM
KLHRNNIFEESYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYY
GLFEYSATDNYTLQINPNSGLCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMML
GKQITLNDMESVDSEYYNSLKWILENDPTELDLMFCIDEENFGQTYQVDLKPNGSEIMVT
NENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLIKIFDENELELLMCGLGDVDV
NDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPMNGFAELYGSN
GPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD
NT seq 2508 nt   +upstreamnt  +downstreamnt
atggagcgaccctacacgtttaaggactttctgctcaggccgaggagccacaaatcccgt
gtgaaggggttcctgcggctcaaaatggcttacatgcccaaaaacggggcccaagacgag
gagaacagcgagcccagggacgacatggagcatgggtgggaagtggtcgactccaacgat
tcagcctctcagcaccaggaggagctgccgcccccgcctctgccccccgggtgggaggaa
aaagtggacaatttaggccgaacgtactacgtcaaccacaacaaccgcaccacgcagtgg
caccgaccaagcttgatggacgtgtcctccgagtcggacagcaacatccggcagatcaac
caggaggcagcacaccggcgcttccgctcccgcaggcacatcagcgaggacctggagccg
gagccgtccgagggcggagaggcccccgagccctgggagaccatttcagaagaagtgaat
ctggctggtgactccctggggcttgccgtgcccccgccgcccgcctcccctgtgtcccgg
accagcccccaggagctgacagaggagctgagcaggcggcttcaggtcactccggacgcc
aacggggagcagttcagttccctcatccagagagagccctcctccaggctgcgttcctgc
agtgtcaccgacgccgtcgccgagcaggcccatctgccaccgccgtcagtggcctatgta
cacaccacgccgggccttccttcaggctgggaagaaaggaaagatgctaagggacgcaca
tactatgtcaatcataacaatcgaaccacaacttggactcggcccatcatgcagcttgca
gaagacggcgccgcctccggatcggccacaaacagtagcaaccacctaatcgagcctcag
atccgccggcctcgtagcctcagctcgccaacagtaactttatctgccccgctggagggt
gccaaggactcccccgtgcgtcgggctgtgaaagacaccctttccaacccacagtcccca
cagccgtccccctacaactcccccaaacctcagcacagagtcacccagagcttcctgccg
cccggctgggagatgaggatcgcgcccaacggccggcccttcttcattgaccacaacaca
aagacgacgacgtgggaagatccacgcctgaagttcccagttcatatgcggtcaaaggca
tctttaaaccccaatgacctcggccctctcccgcctggctgggaagaaaggattcacttg
gacggccggacgttctacatcgatcacaacagcaaaatcacccagtgggaagacccaaga
ctgcagaacccagccatcaccggtccggctgttccttattccagagaatttaagcagaaa
tacgactacttcaggaagaagctgaagaagccggctgatattccgaacagatttgaaatg
aagctccacaggaacaacatattcgaagaatcctaccggaggatcatgtcggtgaaaaga
ccagatgtcctgaaagccagactctggatagaattcgagtcggagaaaggcctggactat
gggggcgtggccagagaatggttcttcctactgtccaaagagatgttcaacccttactat
ggtctctttgagtactctgccacggacaactacacacttcaaatcaaccccaattcaggc
ctctgtaatgaagaccacttgtcctatttcacgtttatcgggagagtcgcgggtctggcc
gtatttcatgggaagctcttggatggtttcttcatccgcccgttttacaaaatgatgctg
gggaagcagataaccctgaacgacatggagtccgtggacagtgaatactacaactctttg
aagtggatcttagaaaatgaccccaccgaactggacctcatgttctgcatagatgaggag
aacttcgggcagacataccaagtggacctgaagcccaatggctcagagataatggtgacg
aatgaaaacaaaagggaatatatcgacttggtcatccagtggaggttcgtgaaccgggtc
cagaagcagatgaacgccttcctagagggattcacagaactccttcccattgacctgatt
aaaatttttgatgaaaatgagctggagttgctgatgtgtggtctcggggatgtggacgtg
aacgactggagacagcattctatctacaagaacggctactgcccaaaccacccggtcatc
cagtggttctggaaggctgtgcttctgatggacgccgagaagcgcatccggttactgcag
tttgtcacgggcacgtcccgggtacctatgaatggatttgccgaactttatggttccaat
ggtcctcagctgtttacaatagagcaatggggaagtcctgaaaagctgcccagagctcac
acatgctttaatcgcctcgacttacctccgtacgaaaccttcgaagatttacgggagaaa
ctgctcatggccgtggagaacgcccagggcttcgaaggggtggattaa

DBGET integrated database retrieval system