KEGG   Oryctolagus cuniculus (rabbit): 100009423
Entry
100009423         CDS       T03373                                 
Symbol
PPP3CA
Name
(RefSeq) protein phosphatase 3 catalytic subunit alpha
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04720  Long-term potentiation
ocu04724  Glutamatergic synapse
ocu04728  Dopaminergic synapse
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009423 (PPP3CA)
   04310 Wnt signaling pathway
    100009423 (PPP3CA)
   04370 VEGF signaling pathway
    100009423 (PPP3CA)
   04020 Calcium signaling pathway
    100009423 (PPP3CA)
   04022 cGMP-PKG signaling pathway
    100009423 (PPP3CA)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009423 (PPP3CA)
   04218 Cellular senescence
    100009423 (PPP3CA)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100009423 (PPP3CA)
   04650 Natural killer cell mediated cytotoxicity
    100009423 (PPP3CA)
   04660 T cell receptor signaling pathway
    100009423 (PPP3CA)
   04658 Th1 and Th2 cell differentiation
    100009423 (PPP3CA)
   04659 Th17 cell differentiation
    100009423 (PPP3CA)
   04662 B cell receptor signaling pathway
    100009423 (PPP3CA)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100009423 (PPP3CA)
   04921 Oxytocin signaling pathway
    100009423 (PPP3CA)
   04924 Renin secretion
    100009423 (PPP3CA)
  09156 Nervous system
   04724 Glutamatergic synapse
    100009423 (PPP3CA)
   04728 Dopaminergic synapse
    100009423 (PPP3CA)
   04720 Long-term potentiation
    100009423 (PPP3CA)
  09158 Development and regeneration
   04360 Axon guidance
    100009423 (PPP3CA)
   04380 Osteoclast differentiation
    100009423 (PPP3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100009423 (PPP3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009423 (PPP3CA)
   05170 Human immunodeficiency virus 1 infection
    100009423 (PPP3CA)
   05163 Human cytomegalovirus infection
    100009423 (PPP3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009423 (PPP3CA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100009423 (PPP3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009423 (PPP3CA)
   05014 Amyotrophic lateral sclerosis
    100009423 (PPP3CA)
   05020 Prion disease
    100009423 (PPP3CA)
   05022 Pathways of neurodegeneration - multiple diseases
    100009423 (PPP3CA)
  09165 Substance dependence
   05031 Amphetamine addiction
    100009423 (PPP3CA)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009423 (PPP3CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009423 (PPP3CA)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100009423 (PPP3CA)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100009423 (PPP3CA)
SSDB
Motif
Pfam: Metallophos
Other DBs
NCBI-GeneID: 100009423
NCBI-ProteinID: NP_001076161
Ensembl: ENSOCUG00000011398
UniProt: Q8HZN0
LinkDB
Position
15:48503535..48830118
AA seq 511 aa
MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLMKEGRLEESV
ALRIITEGASILRQEKNLLDIDAPVTVCGDIHGQFFDLMKLFEVGGSPANTRYLFLGDYV
DRGYFSIECVLYLWALKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMD
AFDCLPLAALMNQQFLCVHGGLSPEINTLDDIRKLDRFKEPPAYGPMCDILWSDPLEDFG
NEKTQEHFTHNTVRGCSYFYSYPAVCEFLQHNNLLSILRAHEAQDAGYRMYRKSQTTGFP
SLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEK
VTEMLVNVLNICSDDELGSEEDGFDGATAAARKEVIRNKIRAIGKMARVFSVLREESESV
LTLKGLTPTGMLPSGVLSGGKQTLQSAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAM
PSDANLNSINKALASETNGTDSNGSNNSNIQ
NT seq 1536 nt   +upstreamnt  +downstreamnt
atgtccgagcccaaggcgattgatcccaagttgtcgacgaccgacagggtggtgaaagct
gtcccatttcctccaagtcaccggctcacagcaaaggaagtgtttgataatgatgggaaa
cctcgtgtggatatcttaaaagcacatctcatgaaggagggcagactggaagagagtgtt
gcgttgagaataataacagaaggcgcttcaattcttcgacaggaaaaaaacttgctggat
attgatgcgccggtcacagtttgtggggacatccatggacaattctttgacttgatgaag
ctctttgaagtggggggatcacctgccaacactcgctacctcttcttaggggactatgtt
gacagagggtacttcagtatcgaatgtgtgctgtatttgtgggctttgaaaattctttac
ccaaaaacactgtttttacttcgtggaaatcatgaatgtagacatctaacagagtatttc
acatttaaacaagaatgtaaaataaagtattcagaacgtgtctatgatgcctgtatggat
gcctttgactgccttcccctggctgccctgatgaaccaacagtttctgtgtgtacatggt
ggcttgtctccagagattaacaccttagatgatatcagaaaattagaccgattcaaagaa
ccacctgcttatggaccgatgtgtgacatcctgtggtcagaccccctggaggattttgga
aacgagaagactcaggaacacttcactcacaacacagtccgagggtgttcgtacttctac
agttacccggctgtatgtgaattcttgcagcacaataacttgttatccatactccgagcc
catgaagcccaagatgcagggtatcgcatgtacaggaaaagccaaacaacaggcttccct
tctctaatcacaattttttcagcaccaaattacttagatgtatacaataacaaagctgca
gtattgaagtatgagaacaatgttatgaatatcaggcaattcaactgttcgccacatcca
tactggcttccaaatttcatggatgttttcacttggtccctgccatttgttggagaaaaa
gtcactgagatgctggtaaacgtcctcaacatctgctcagatgatgaactagggtcagag
gaagatggatttgatggagccacagctgcagcccgcaaggaggtaataaggaacaagatc
cgcgccataggcaaaatggcccgagtgttctccgtcctcagagaagagagtgagagtgtg
ctgacactgaaaggcctgacgcccaccggcatgctccccagtggagtgctctctggaggg
aagcagaccctgcaaagcgccatcaaaggattttcaccacaacataagatcactagcttc
gaagaggccaagggcttagaccgaattaacgagaggatgccgcctcgcagggatgccatg
ccctccgacgccaaccttaactccatcaacaaggctctcgcctcagagactaacggcacg
gacagcaatggcagtaacaacagcaatatccagtga

KEGG   Oryctolagus cuniculus (rabbit): 100009487
Entry
100009487         CDS       T03373                                 
Symbol
PPP3CB
Name
(RefSeq) protein phosphatase 3 catalytic subunit beta
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04720  Long-term potentiation
ocu04724  Glutamatergic synapse
ocu04728  Dopaminergic synapse
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100009487 (PPP3CB)
   04310 Wnt signaling pathway
    100009487 (PPP3CB)
   04370 VEGF signaling pathway
    100009487 (PPP3CB)
   04020 Calcium signaling pathway
    100009487 (PPP3CB)
   04022 cGMP-PKG signaling pathway
    100009487 (PPP3CB)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100009487 (PPP3CB)
   04218 Cellular senescence
    100009487 (PPP3CB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100009487 (PPP3CB)
   04650 Natural killer cell mediated cytotoxicity
    100009487 (PPP3CB)
   04660 T cell receptor signaling pathway
    100009487 (PPP3CB)
   04658 Th1 and Th2 cell differentiation
    100009487 (PPP3CB)
   04659 Th17 cell differentiation
    100009487 (PPP3CB)
   04662 B cell receptor signaling pathway
    100009487 (PPP3CB)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100009487 (PPP3CB)
   04921 Oxytocin signaling pathway
    100009487 (PPP3CB)
   04924 Renin secretion
    100009487 (PPP3CB)
  09156 Nervous system
   04724 Glutamatergic synapse
    100009487 (PPP3CB)
   04728 Dopaminergic synapse
    100009487 (PPP3CB)
   04720 Long-term potentiation
    100009487 (PPP3CB)
  09158 Development and regeneration
   04360 Axon guidance
    100009487 (PPP3CB)
   04380 Osteoclast differentiation
    100009487 (PPP3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100009487 (PPP3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100009487 (PPP3CB)
   05170 Human immunodeficiency virus 1 infection
    100009487 (PPP3CB)
   05163 Human cytomegalovirus infection
    100009487 (PPP3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100009487 (PPP3CB)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100009487 (PPP3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100009487 (PPP3CB)
   05014 Amyotrophic lateral sclerosis
    100009487 (PPP3CB)
   05020 Prion disease
    100009487 (PPP3CB)
   05022 Pathways of neurodegeneration - multiple diseases
    100009487 (PPP3CB)
  09165 Substance dependence
   05031 Amphetamine addiction
    100009487 (PPP3CB)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009487 (PPP3CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100009487 (PPP3CB)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100009487 (PPP3CB)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100009487 (PPP3CB)
SSDB
Motif
Pfam: Metallophos DUF5378
Other DBs
NCBI-GeneID: 100009487
NCBI-ProteinID: NP_001076196
Ensembl: ENSOCUG00000012543
UniProt: Q8HZM9
LinkDB
Position
18:13943053..14007188
AA seq 524 aa
MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDVDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHNAQ
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggccgccccggagccggcgcgggccgcaccgcccccacccccgcccccgccgccccct
cccggggctgaccgcgtcgtcaaagctgtccctttccctccaacacatcgtttgacatct
gaagaagtatttgatgtggacgggatacccagggttgatgttttgaagaaccacttagta
aaagaaggtcgagtagatgaagaaattgcacttagaattatcaatgagggtgctgccatc
cttcggagagagaaaaccatgatagaagtagaagctccaattacagtgtgtggtgatatc
catggccaattttttgatctgatgaaactgtttgaagtaggaggatcacctgctaataca
cgatacctttttcttggtgattatgtggacagaggttactttagtatagagtgtgtctta
tatttatgggtcttgaagattctgtacccaagcacattatttcttctgagaggaaaccat
gaatgcagacaccttactgaatattttacctttaaacaggaatgtaaaattaaatattca
gaaagagtctatgaagcttgtatggaagcttttgatagcctgcctcttgctgcactttta
aaccaacagtttctctgtgttcatggtggactttcacccgaaatacacacactggatgat
attaggagattagatagattcaaagagccacctgcatttggaccaatgtgtgacttgcta
tggtccgatccttctgaagattttggaaatgaaaaatcacaggaacattttagtcacaat
acagttcgaggatgttcttatttttataactatccagcagtgtgtgaatttttgcaaaac
aataatttgttatcgattattagagctcatgaagctcaagatgcaggctatagaatgtac
agaaaaagtcaaactacagggttcccttcattaataacaattttttcggcccctaattac
ttagatgtctacaataataaagctgctgtattaaagtatgaaaataatgtgatgaatatt
cgacagtttaactgttctccacatccttactggttacccaattttatggatgtcttcaca
tggtctttaccatttgttggggaaaaagtgaccgaaatgttggtaaatgtcttgagtatt
tgctctgatgatgaactaatgactgaaggtgaagaccaatttgatggttcagctgcagcc
cggaaagaaatcataagaaacaaaattcgagcaattggcaagatggcaagagtcttctct
gttctcagggaggagagtgaaagtgtgctgacactcaagggcctgactcccacagggatg
ttgcctagtggagtgttggctggaggacggcagaccctacaaagtgccacagttgaggct
attgaggctgaaaaagcaatacgaggattctctccaccacatagaatctgcagttttgaa
gaggcaaagggtttggataggatcaatgagagaatgccaccccggaaagatgctgtacag
caagatggtttcaattctctgaacaccgcacatgccactgagaaccacgggactggcaac
cataatgcccagtga

KEGG   Oryctolagus cuniculus (rabbit): 100344533
Entry
100344533         CDS       T03373                                 
Symbol
PPP3R2
Name
(RefSeq) protein phosphatase 3 regulatory subunit B, beta
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04720  Long-term potentiation
ocu04724  Glutamatergic synapse
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100344533 (PPP3R2)
   04310 Wnt signaling pathway
    100344533 (PPP3R2)
   04370 VEGF signaling pathway
    100344533 (PPP3R2)
   04020 Calcium signaling pathway
    100344533 (PPP3R2)
   04022 cGMP-PKG signaling pathway
    100344533 (PPP3R2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100344533 (PPP3R2)
   04218 Cellular senescence
    100344533 (PPP3R2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100344533 (PPP3R2)
   04650 Natural killer cell mediated cytotoxicity
    100344533 (PPP3R2)
   04660 T cell receptor signaling pathway
    100344533 (PPP3R2)
   04658 Th1 and Th2 cell differentiation
    100344533 (PPP3R2)
   04659 Th17 cell differentiation
    100344533 (PPP3R2)
   04662 B cell receptor signaling pathway
    100344533 (PPP3R2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100344533 (PPP3R2)
   04921 Oxytocin signaling pathway
    100344533 (PPP3R2)
   04924 Renin secretion
    100344533 (PPP3R2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100344533 (PPP3R2)
   04720 Long-term potentiation
    100344533 (PPP3R2)
  09158 Development and regeneration
   04360 Axon guidance
    100344533 (PPP3R2)
   04380 Osteoclast differentiation
    100344533 (PPP3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100344533 (PPP3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100344533 (PPP3R2)
   05170 Human immunodeficiency virus 1 infection
    100344533 (PPP3R2)
   05163 Human cytomegalovirus infection
    100344533 (PPP3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100344533 (PPP3R2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100344533 (PPP3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100344533 (PPP3R2)
   05014 Amyotrophic lateral sclerosis
    100344533 (PPP3R2)
   05020 Prion disease
    100344533 (PPP3R2)
   05022 Pathways of neurodegeneration - multiple diseases
    100344533 (PPP3R2)
  09165 Substance dependence
   05031 Amphetamine addiction
    100344533 (PPP3R2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100344533 (PPP3R2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100344533 (PPP3R2)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100344533 (PPP3R2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9 YtfJ_HI0045
Other DBs
NCBI-GeneID: 100344533
NCBI-ProteinID: XP_002708194
LinkDB
Position
1:11367835..11368802
AA seq 170 aa
MGNEASYPAEMCSHFDHDEIRRLGKRFRKLDLDKSGTLSVEEFMSLPELQQNPLVKRVID
IFDMDGNGEVDFKEFILGTSQFSVKGNEEQKLRFAFSIYDMDKDGYISNGELFQVLKMMV
GNNLRDWQLQELVDKTIIILDKDGDGKISFEEFSTVVRGLEFHKKLVVIV
NT seq 513 nt   +upstreamnt  +downstreamnt
atgggaaacgaggccagctacccggcagagatgtgctcccactttgaccatgatgaaatt
agaagactgggcaaaaggtttaggaagctggacctggacaagtcgggcactctgagcgtg
gaggagttcatgtccctgccagagcttcagcagaacccgttggtgaagcgagtgatcgac
atcttcgacatggacggcaatggagaagtggacttcaaggaattcatcttggggacctct
cagttcagcgtcaaaggaaacgaggagcagaagctgaggtttgctttcagcatctacgac
atggacaaggacggctatatttccaacggtgagctcttccaggtgctgaagatgatggtg
ggtaacaacctcagggactggcagttgcaggagctggttgacaaaaccatcatcatcctg
gacaaggatggcgatgggaaaatatcctttgaggaattcagcactgtggttagaggcctg
gagttccacaagaagttggtcgtcattgtatga

KEGG   Oryctolagus cuniculus (rabbit): 100356245
Entry
100356245         CDS       T03373                                 
Symbol
PPP3CC
Name
(RefSeq) protein phosphatase 3 catalytic subunit gamma
  KO
K04348  serine/threonine-protein phosphatase 2B catalytic subunit [EC:3.1.3.16]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04020  Calcium signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04114  Oocyte meiosis
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04370  VEGF signaling pathway
ocu04380  Osteoclast differentiation
ocu04625  C-type lectin receptor signaling pathway
ocu04650  Natural killer cell mediated cytotoxicity
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu04660  T cell receptor signaling pathway
ocu04662  B cell receptor signaling pathway
ocu04720  Long-term potentiation
ocu04724  Glutamatergic synapse
ocu04728  Dopaminergic synapse
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu05010  Alzheimer disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100356245 (PPP3CC)
   04310 Wnt signaling pathway
    100356245 (PPP3CC)
   04370 VEGF signaling pathway
    100356245 (PPP3CC)
   04020 Calcium signaling pathway
    100356245 (PPP3CC)
   04022 cGMP-PKG signaling pathway
    100356245 (PPP3CC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100356245 (PPP3CC)
   04218 Cellular senescence
    100356245 (PPP3CC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100356245 (PPP3CC)
   04650 Natural killer cell mediated cytotoxicity
    100356245 (PPP3CC)
   04660 T cell receptor signaling pathway
    100356245 (PPP3CC)
   04658 Th1 and Th2 cell differentiation
    100356245 (PPP3CC)
   04659 Th17 cell differentiation
    100356245 (PPP3CC)
   04662 B cell receptor signaling pathway
    100356245 (PPP3CC)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100356245 (PPP3CC)
   04921 Oxytocin signaling pathway
    100356245 (PPP3CC)
   04924 Renin secretion
    100356245 (PPP3CC)
  09156 Nervous system
   04724 Glutamatergic synapse
    100356245 (PPP3CC)
   04728 Dopaminergic synapse
    100356245 (PPP3CC)
   04720 Long-term potentiation
    100356245 (PPP3CC)
  09158 Development and regeneration
   04360 Axon guidance
    100356245 (PPP3CC)
   04380 Osteoclast differentiation
    100356245 (PPP3CC)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100356245 (PPP3CC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100356245 (PPP3CC)
   05170 Human immunodeficiency virus 1 infection
    100356245 (PPP3CC)
   05163 Human cytomegalovirus infection
    100356245 (PPP3CC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356245 (PPP3CC)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100356245 (PPP3CC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100356245 (PPP3CC)
   05014 Amyotrophic lateral sclerosis
    100356245 (PPP3CC)
   05020 Prion disease
    100356245 (PPP3CC)
   05022 Pathways of neurodegeneration - multiple diseases
    100356245 (PPP3CC)
  09165 Substance dependence
   05031 Amphetamine addiction
    100356245 (PPP3CC)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100356245 (PPP3CC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100356245 (PPP3CC)
Enzymes [BR:ocu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100356245 (PPP3CC)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Catalytic subunits
     100356245 (PPP3CC)
SSDB
Motif
Pfam: Metallophos DUF5378 PTEN_C2
Other DBs
NCBI-GeneID: 100356245
NCBI-ProteinID: XP_008248097
Ensembl: ENSOCUG00000006535
LinkDB
Position
Un
AA seq 521 aa
MSGRRFQLSTTERVIKAVPFPPTQRLTLKEVFENGKPKVEVLKNHLVKEGRLEEEVALKI
IKDGAAILRQEKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPSNTRYLFLGDYVDRGY
FSIECVLYLWSLKINHPKTLFLLRGNHECRHLTEYFTFKQECRIKYSEQVYDACMDTFDC
LPLAALLNQQFLCVHGGMSPEITSLDDIRKLDRFTEPPAFGPVCDLLWSDPAEDYGNEKT
LEHYTHNTVRGCSYFFSYPAVCEFLQNNNLLSIIRAHEAQDAGYRMYRKSQATGFPSLIT
IFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFTWSLPFVGEKVTEM
LVNILNICSDDELISDEEAEDHYISSSQKGGTSVRKEIIKNKIRAIGKMARVFSILREES
ESVLALKGLTPTGTLPLGVLSGGKQTIETATVEAVEAREAIRGFSLPHKIRSFEEARGLD
RINERMPPRKDGVHSAGPVKSATPAHPDTAHRSELGRKAQQ
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgtccgggaggcgcttccaactctccaccaccgagcgcgtcatcaaagctgtccccttt
cctccaacccagcggcttactttgaaggaagtatttgagaatgggaaacctaaagtggag
gttttgaaaaaccatctggtaaaggaaggccggctggaagaggaagtagccttaaagatc
atcaaagatggggctgccatcctgaggcaggagaagaccatgatcgaagtggaggctccg
atcacagtgtgtggcgacattcatggacaattctttgatctaatgaagctgtttgaagtt
ggaggatcacctagtaacacacgctacctctttctgggagactatgtggacagaggctat
ttcagtatagagtgtgtgctgtatttgtggagtttaaagattaatcatcccaaaacgttg
tttctgcttcgaggaaatcatgaatgcaggcatctaacagagtatttcaccttcaaacag
gaatgtcgaatcaaatattctgaacaggtgtatgacgcgtgtatggacacgtttgactgt
ctccctctggctgccctcttgaaccagcagtttctctgtgtacatggaggaatgtcacct
gaaatcactagcttagatgacattaggaaattagataggttcactgagcctcctgccttc
gggccagtgtgcgacctgctttggtctgatcccgctgaggattacggcaacgagaagacc
ttggagcactatacccacaacactgtccgcgggtgctcttacttcttcagttaccctgca
gtttgtgaatttttacaaaacaacaatttattatcaataatcagagcgcacgaagcccag
gacgctggatatcgaatgtataggaagagccaggcaacaggcttcccgtcgctcattaca
atcttctcggcccctaattacctagatgtctataacaataaagctgctgtgttgaaatat
gaaaacaatgtcatgaacatcagacagttcaactgttctccccacccctactggcttccg
aacttcatggatgttttcacgtggtctttgccttttgttggggagaaagtcacagagatg
ctggttaacatcctgaacatatgctctgatgatgaactgatttcagatgaggaagcagaa
gatcactacatttcaagttctcagaaaggaggcacttcagttcggaaagaaatcatcaag
aataagatcagagccattggaaagatggcgcgggtcttttcaatcctgcgggaagagagt
gagagtgtgctggctctcaagggcctgacccccacaggcaccctccccctgggcgtcctg
tctggagggaagcagactatcgagacggccacagtagaagccgtagaggcccgggaagcc
atccgagggttttcgcttccgcacaagatccggagttttgaagaagcccgaggtctggac
cgaattaacgagcgaatgccaccccggaaagatggcgtgcactcggctgggccagtgaag
tcagcgacgccggcgcacccggacacagcgcacaggagcgagctggggaggaaagcccag
cagtga

DBGET integrated database retrieval system