KEGG   Oryctolagus cuniculus (rabbit): 100009456
Entry
100009456         CDS       T03373                                 
Symbol
HSP90B1, TRA1
Name
(RefSeq) heat shock protein 90 beta family member 1
  KO
K09487  heat shock protein 90kDa beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04151  PI3K-Akt signaling pathway
ocu04657  IL-17 signaling pathway
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu05132  Salmonella infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100009456 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100009456 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100009456 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100009456 (HSP90B1)
   04918 Thyroid hormone synthesis
    100009456 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009456 (HSP90B1)
   05207 Chemical carcinogenesis - receptor activation
    100009456 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100009456 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009456 (HSP90B1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009456 (HSP90B1)
   05418 Fluid shear stress and atherosclerosis
    100009456 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100009456 (HSP90B1)
Chaperones and folding catalysts [BR:ocu03110]
 Heat shock proteins
  HSP90
   100009456 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 100009456
NCBI-ProteinID: XP_008255217
Ensembl: ENSOCUG00000016288
UniProt: G1TBC1
LinkDB
Position
4:83093857..83110798
AA seq 802 aa
MRALWVLGLCCVLLTFGSARADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDEQALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPAEEEEAAK
EEKEEADDEAAVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEEDEYKAFYK
SFSKESDDPMAYIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITD
DFHDMMPKYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKY
NDTFWKEFGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPTDITSLDQYVERMKEKQDKIYF
MAGASRKEAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDE
SEKTKESREATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMER
IMKAQAYQTGKDISTNYYASQKKTFEINPRHPLIRDMLRRIKEDEDDKTVMDLAVVLFET
ATLRSGYLLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEDTTEDTEQDEEEEMDA
GTDEEEQEQEPEKKSTAEKDEL
NT seq 2409 nt   +upstreamnt  +downstreamnt
atgagggccctgtgggtgctgggcctctgctgcgtcctgctgaccttcggctcggcccgg
gccgacgacgaggtggacgtggacggcaccgtggaagaggatctggggaagagcagggaa
gggtcgaggacggacgacgaggtcgtacagagagaggaagaagccattcagttggatgga
ctcaatgcatcccaaatacgagaacttagagagaaatctgagaagtttgccttccaagct
gaagttaacaggatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ctgagagaactgatttccaatgcttcagatgctttggataagataaggctgatatcactg
actgatgaacaagctctttctggaaatgaggaactaacagtcaaaattaagtgcgacaag
gagaagaacctgctgcatgtcacagacactggtgtgggaatgactagagaagagttggtt
aaaaaccttggtaccatagccaagtctggcacgagcgagtttttaaacaaaatgactgag
gcacaagaagatggccagtcaacttccgaattgatcggccagtttggtgttggtttctat
tctgccttccttgtagcagacaaggttatagtcacatccaaacacaacaacgatacccag
cacatctgggagtccgactccaatgaattttctgtaattgctgacccaagaggaaacact
ctgggacggggaacaacaattacccttgtcttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatcttgtcaagaaatactcacagttcataaacttccctatttac
gtgtggagcagcaagacggagacggtcgaggagcccgcggaagaggaggaggcagcaaaa
gaagaaaaagaagaagccgatgacgaagctgcagtagaagaagaagaagaagaaaagaaa
ccaaaaactaaaaaagttgagaaaacagtctgggattgggaacttatgaatgatatcaaa
ccaatatggcagagaccatcaaaagaagtagaagaagatgaatacaaagctttctacaaa
tcattttcaaaggaaagtgatgaccccatggcctatatccacttcactgctgaaggagaa
gttacctttaaatccattttatttgtacctacatctgctccacgtggtctgtttgacgaa
tatggatctaagaagagtgattacattaagctctacgtgcgccgggtgttcatcacagat
gacttccatgacatgatgcctaagtacctgaattttgtcaagggtgttgtggactcggac
gacctccccttgaatgtttcccgtgagaccctccagcagcataaactgcttaaggtgatc
aggaagaagcttgtccgtaaaactctggacatgatcaagaagattgctgatgagaaatac
aacgacactttctggaaagaattcggtaccaacatcaagcttggtgtaattgaggatcac
tccaatcgaacacgtcttgctaaactgcttcgattccagtcttcccaccacccaactgac
attactagtctagaccagtatgtggaaagaatgaaggaaaaacaggacaaaatctacttc
atggctggggccagcagaaaagaggccgaatcgtctccatttgttgagcggcttctgaag
aagggctatgaagtcatttacctcacagaacctgtggacgaatactgcattcaggccctt
cctgagtttgatgggaaaaggttccagaatgtggccaaggaaggggtgaagtttgatgaa
agcgagaaaacgaaggagagtcgtgaagcaaccgagaaagaatttgagcctctgctcaac
tggatgaaagacaaagccctcaaggacaagattgaaaaggctgtggtgtctcagcgcctg
accgagtctccgtgtgctctggtggccagccagtacggatggtctggcaacatggagaga
atcatgaaagcccaggcctaccaaacgggcaaggacatctctacaaattactatgccagt
caaaagaagacatttgaaatcaatcccagacatccactgatcagagacatgcttcgacga
attaaggaagatgaagatgacaagactgttatggatcttgctgtggttttgtttgaaaca
gcgacacttcggtcaggatatcttttaccggacactaaagcatatggagatagaatagaa
agaatgcttcgcctcagcttgaacattgaccctgatgcaaaggtggaagaagaacccgag
gaggagccagaagacaccacagaagacaccgagcaagatgaagaagaagaaatggatgct
ggcacggatgaagaggaacaggaacaggaaccagaaaagaaatcgacagctgaaaaagat
gaattgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100338694
Entry
100338694         CDS       T03373                                 
Symbol
HSP90AA1, HSPCA
Name
(RefSeq) heat shock protein 90 alpha family class A member 1
  KO
K04079  molecular chaperone HtpG
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04612  Antigen processing and presentation
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04659  Th17 cell differentiation
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu05132  Salmonella infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100338694 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100338694 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100338694 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100338694 (HSP90AA1)
   04612 Antigen processing and presentation
    100338694 (HSP90AA1)
   04659 Th17 cell differentiation
    100338694 (HSP90AA1)
   04657 IL-17 signaling pathway
    100338694 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100338694 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    100338694 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338694 (HSP90AA1)
   05207 Chemical carcinogenesis - receptor activation
    100338694 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100338694 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100338694 (HSP90AA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100338694 (HSP90AA1)
   05418 Fluid shear stress and atherosclerosis
    100338694 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100338694 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100338694 (HSP90AA1)
   04131 Membrane trafficking [BR:ocu04131]
    100338694 (HSP90AA1)
   03051 Proteasome [BR:ocu03051]
    100338694 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100338694 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100338694 (HSP90AA1)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100338694 (HSP90AA1)
Chaperones and folding catalysts [BR:ocu03110]
 Heat shock proteins
  HSP90
   100338694 (HSP90AA1)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100338694 (HSP90AA1)
Proteasome [BR:ocu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100338694 (HSP90AA1)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100338694 (HSP90AA1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100338694 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12 Zip
Other DBs
NCBI-GeneID: 100338694
NCBI-ProteinID: XP_002721768
Ensembl: ENSOCUG00000001280
LinkDB
Position
Un
AA seq 731 aa
MPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDAGEPM
GRGTKVVLHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KDKEEEDKQPDDKPEIEDVGSDEEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWTRNP
DDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNNI
KLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKCL
ELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDYC
TRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKTL
VSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIVT
STYGWTANMERIMKAQALRDNSTMGYMAAKKHLEVNPDHSIIETLRQKAEADKNDKSVKD
LVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTAAAVTEEMPPLEG
DDDTSRMEEVD
NT seq 2196 nt   +upstreamnt  +downstreamnt
atgcccgaggagacccagacccaagaccagccgatggaggaggaggaggtggagacgttc
gccttccaggcggaaatcgcccagttgatgtccctcatcatcaacactttctactcgaac
aaagagatcttcctgcgggagctgatctcgaactcgtcggatgctctggacaagatccgc
tatgaaagcctaaccgaccccagcaagctggactcgggcaaggagctgcacatcaacctg
attcccaacaagcaagaccgaaccctgaccatcgtggacacgggcatcggcatgaccaag
gccgacctgatcaacaacctgggcaccatcgccaagtccggcaccaaggccttcatggag
gcgctgcaggctggcgccgacatctccatgattggccagttcggggtcggcttctactcg
gcgtacctggtggctgagaaggtgacggtgatcaccaagcacaacgacgacgagcagtac
gcctgggagtcctcggcggggggctcgttcaccgtgcggaccgacgcaggtgagcccatg
gggcgcggcacgaaggtggtgctgcacctgaaggaggaccagacggagtacctggaggag
cggcgcatcaaggagatcgtgaagaagcactcgcagttcatcggctaccccatcacgctg
ttcgtggagaaggagcgcgacaaggaggtgagcgacgacgaggccgaggagaaggaggac
aaggacaaggaggaggaggacaagcagcccgacgacaagccggagatcgaggacgtgggc
tcggacgaggaggaggaggagaagaaggacggcgacaagaagaagaagaagaagatcaag
gagaagtacatcgaccaggaggagctcaacaagacgaagcccatctggaccaggaacccc
gacgacatcaccaacgaggagtacggggagttctacaagagcctgaccaacgactgggag
gaccacttggccgtgaagcacttctcggttgaggggcagctggagttcagagcgctgctc
ttcgtcccgagacgagccccgtttgacctgtttgaaaaccggaagaagaagaacaacatc
aagttgtacgttcgcagagtcttcatcatggacaactgtgaggagctgatccctgagtac
ctgaatttcatcagaggggtggtggactcggaggacctcccgctgaacatctcccgggag
atgctgcagcagagcaagatcctgaaagttatcaggaagaacttggtcaaaaagtgtctg
gaactcttcacggaactggcagaagacaaagagaattacaagaagttttatgagcagttc
tccaaaaatataaagctggggatccacgaggactcccagaaccgcaagaagctttccgag
ctgctgaggtactacacgtcggcctccggcgacgagatggtgtccctcaaggactactgc
accaggatgaaggagaaccagaagcacatctactacatcacaggtgagaccaaggaccag
gtggcgaactctgccttcgtggagcgcctgcggaagcacggcctggaggtgatctacatg
atcgagcccatcgacgagtactgcgtgcagcagctgaaggagttcgaggggaagacgctc
gtgtccgtcaccaaggagggcttggagctgccggaggacgaggaggagaagaagaagcag
gaggagaagaagacgaagttcgagaacctctgcaagatcatgaaggacatactggagaag
aaagtggagaaggtggtggtgtcaaacagattggtgacctctccgtgctgcatcgtcaca
agcacgtacggctggacggccaacatggagaggatcatgaaagcccaggccctgagagac
aactccacgatgggctacatggctgcgaagaagcacctagaggtcaaccccgaccactcc
atcatcgagaccctgaggcagaaggcggaggcggacaagaacgacaagtccgtgaaggac
ctggtcatcctgctctatgagaccgcgctgctctcctccggcttcagtctggaggacccg
cagacacacgccaacaggatctacaggatgatcaagctcggcctgggcattgatgaagac
gaccccactgctgacgacacggccgcagctgtgacggaggagatgccgcccctggaaggc
gacgacgacacctcccgcatggaggaagtggactag

KEGG   Oryctolagus cuniculus (rabbit): 100358690
Entry
100358690         CDS       T03373                                 
Symbol
HSP90AB1, HSPCB
Name
(RefSeq) heat shock protein 90 alpha family class B member 1
  KO
K04079  molecular chaperone HtpG
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04151  PI3K-Akt signaling pathway
ocu04217  Necroptosis
ocu04612  Antigen processing and presentation
ocu04621  NOD-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04659  Th17 cell differentiation
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu05132  Salmonella infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
ocu05417  Lipid and atherosclerosis
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100358690 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100358690 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    100358690 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100358690 (HSP90AB1)
   04612 Antigen processing and presentation
    100358690 (HSP90AB1)
   04659 Th17 cell differentiation
    100358690 (HSP90AB1)
   04657 IL-17 signaling pathway
    100358690 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100358690 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    100358690 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358690 (HSP90AB1)
   05207 Chemical carcinogenesis - receptor activation
    100358690 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100358690 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100358690 (HSP90AB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100358690 (HSP90AB1)
   05418 Fluid shear stress and atherosclerosis
    100358690 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ocu01009]
    100358690 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ocu03110]
    100358690 (HSP90AB1)
   04131 Membrane trafficking [BR:ocu04131]
    100358690 (HSP90AB1)
   03051 Proteasome [BR:ocu03051]
    100358690 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100358690 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100358690 (HSP90AB1)
Protein phosphatases and associated proteins [BR:ocu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100358690 (HSP90AB1)
Chaperones and folding catalysts [BR:ocu03110]
 Heat shock proteins
  HSP90
   100358690 (HSP90AB1)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100358690 (HSP90AB1)
Proteasome [BR:ocu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100358690 (HSP90AB1)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100358690 (HSP90AB1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100358690 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 CNDH2_C
Other DBs
NCBI-GeneID: 100358690
NCBI-ProteinID: XP_002714493
Ensembl: ENSOCUG00000012842
UniProt: P30947
LinkDB
Position
12:33628560..33633837
AA seq 726 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPSPQDRTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEEKKE
EEDKEDDEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQ
EEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVR
RVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSE
LAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKE
TQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTK
EGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGW
TANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLL
FETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPSAAVPEEIPPLEGDEDAS
RMEEVD
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgcccgaggaagtgcaccatggagaggaggaggtggagactttcgccttccaggcggaa
attgcccaactcatgtctctcatcatcaacaccttctactccaacaaggaaatcttcctg
cgggagctgatctccaacgcgtctgatgccctggacaagatccgctatgagagcctgacg
gacccctccaagctggacagcggcaaagagctgaagatcgacatcatcccgagcccccag
gaccgcacgctgacgctggtggacaccggcattggcatgaccaaggccgatctcatcaac
aacttggggaccatcgccaagtcggggactaaagccttcatggaggctctgcaggctggt
gccgacatctccatgatcgggcagttcggcgtcggtttctattctgcctacctggtggcc
gagaaggtggtcgtgatcacaaagcacaacgatgacgagcagtatgcctgggagtcttct
gctgggggctccttcaccgtgcgcgccgaccacggggagcctattggccgaggcaccaag
gtgatcctgcatctcaaggaggaccagactgagtacctggaggagaggcgggtcaaggag
gtggtgaagaagcactcgcagttcataggctaccccatcaccctctacttggagaaggaa
agagaaaaggaaatcagtgatgatgaagcagaggaagaaaaaggggaagagaaaaaggag
gaggaagataaggaggacgatgagaagcccaagatcgaagatgtgggctccgatgaggaa
gatgacagcggcaaggacaagaaaaagaaaaccaagaagatcaaggagaagtacatcgat
caggaagaactgaacaagaccaagcccatctggaccagaaaccctgatgacatcacccag
gaggagtacggcgagttctacaagagcctcaccaatgactgggaggaccacttggcagtc
aagcacttctccgtggaaggtcagctggaattcagggctttgcttttcatccctcgccga
gctccctttgacctctttgagaacaagaagaagaagaacaacattaagctgtacgtccgc
cgtgtgttcatcatggacagctgtgatgagctgatcccagagtatctcaacttcatccgt
ggcgtggtcgactccgaagacctgcccttgaacatctcccgcgaaatgctgcagcagagc
aagatcttgaaagtcatccgcaagaacatcgtgaagaagtgcctcgagctcttctccgag
ctggcggaagacaaggagaactacaagaagttctatgaggccttctccaagaacttgaag
cttggcatccacgaggactccaccaaccggcgccgcctctctgagctgctgcgctaccac
acctcccagtctggagacgagatgacttcgctgtctgagtacgtctctcgcatgaaggag
acacagaagtccatctactacatcactggggagagcaaagagcaggtggccaactcggct
ttcgtggagcgcgtgcggaagcggggcttcgaggtggtgtacatgacagagccgatcgac
gagtactgcgtgcagcaactcaaggagttcgacgggaagagcttggtgtctgtgaccaaa
gagggcctggagctgcctgaggacgaggaggagaagaagaagatggaggagagcaaggcg
aagtttgagaacctctgcaagctcatgaaggagatcctggataagaaggttgagaaggtg
acaatctccaataggctcgtgtcttcgccctgctgcatcgtgaccagcacctacggctgg
acagccaacatggagcggatcatgaaggcccaggcacttcgagacaactctaccatgggc
tacatgatggccaagaagcacctggagatcaatcccgaccaccccatcgtggagacgctg
aggcagaaggccgaggcggataagaacgacaaggcagtcaaggatctggtggtgctgctc
tttgaaactgcgctgctgtcctccggcttctccctggaggatccccagacccactccaac
cgcatctatcgcatgatcaagctaggcctaggcattgatgaggatgaggtggcagcagag
gaacccagcgcagctgttccggaggagatcccccctctcgagggagatgaggacgcctcc
cgcatggaagaagtagactag

DBGET integrated database retrieval system