KEGG   Oryctolagus cuniculus (rabbit): 100009538
Entry
100009538         CDS       T03373                                 
Symbol
PRKCZ
Name
(RefSeq) protein kinase C zeta
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04144  Endocytosis
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04910  Insulin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05165  Human papillomavirus infection
ocu05415  Diabetic cardiomyopathy
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100009538 (PRKCZ)
   04390 Hippo signaling pathway
    100009538 (PRKCZ)
   04071 Sphingolipid signaling pathway
    100009538 (PRKCZ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100009538 (PRKCZ)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100009538 (PRKCZ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100009538 (PRKCZ)
   04062 Chemokine signaling pathway
    100009538 (PRKCZ)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100009538 (PRKCZ)
   04926 Relaxin signaling pathway
    100009538 (PRKCZ)
  09158 Development and regeneration
   04360 Axon guidance
    100009538 (PRKCZ)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100009538 (PRKCZ)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009538 (PRKCZ)
   05415 Diabetic cardiomyopathy
    100009538 (PRKCZ)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100009538 (PRKCZ)
   04931 Insulin resistance
    100009538 (PRKCZ)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100009538 (PRKCZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100009538 (PRKCZ)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100009538 (PRKCZ)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100009538 (PRKCZ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Kinase-like ABC1 APH Pkinase_C C1_2 Kdo
Other DBs
NCBI-GeneID: 100009538
NCBI-ProteinID: NP_001076227
Ensembl: ENSOCUG00000007082
UniProt: O19111
LinkDB
Position
Un
AA seq 591 aa
MPSRAGPKMDGSGGRVRLKAHYSGDIFITSVDAATTFEELCEEVRDMCGLHQHHPLTLKW
VDSEGDPRTVSSQMELGEAFRLAGQHRDDGLILHVFPSTPEQPGMPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHGLVPLTC
RRHMDSVMPSQEPPVADKSDDADLPSQETDGIAFISTRKQDSGQEDAEDLKPVIDGVDGI
KISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNGQVYAMKVVKKELVHDDEDIDWVQTEK
HVFEQASGNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEIC
IALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPE
ILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFL
SVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITD
DYGLDNSDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSTEESV
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgcccagcagggccggccccaagatggacgggagcggcggccgcgtccggctgaaggcg
cactacagcggggacatcttcatcaccagcgtggacgcggccaccaccttcgaggagctc
tgtgaagaagtgagggacatgtgcggcctgcaccagcaccaccccctcaccctcaagtgg
gtggacagcgaaggtgaccctcgcacggtgtcctcgcagatggagctgggggaggccttc
cgcctggccggccagcacagggacgacgggctcatccttcacgtgttccccagcacgccg
gagcagccaggcatgccgtgtcccggggaagacaaatccatctaccgccgcggagccaga
agatggaggaagctgtaccgtgccaacggccatctcttccaagccaagcgctttaacagg
agagcgtactgtggccagtgcagcgaaaggatatggggtctcgcaaggcagggctacagg
tgcatcaactgcaaactgctggtgcataagcgttgccacggcctcgtcccgctgacctgc
aggaggcatatggattctgtcatgccttcgcaagagcctccagtagccgacaagagcgac
gacgcggaccttccttcccaggagactgacggaatcgctttcatctccacccggaagcag
gacagcggccaggaggacgccgaggacctcaagcccgtgatcgacggcgtggacggcatc
aagatctctcaggggctcgggctgcaggacttcgacctcatcagggtcatcgggcgcggc
agctacgccaaggtcctcttggtgcggctcaagaagaacggccaggtctacgccatgaag
gtcgtgaagaaggagctggtccacgacgacgaggacatcgactgggtgcagacggagaag
cacgtgtttgaacaggcgtccggcaaccccttcctggtcggcctgcactcctgcttccag
acgacaagtcggttgttcctggtcatagagtacgtcaacggaggcgaccttatgttccac
atgcagagacagaggaagctcccggaggagcacgccaggttctacgccgcggagatctgc
atcgccctcaacttcctgcacgagagagggatcatctaccgggacctgaagctggacaac
gtcctcctggacgccgacggccacatcaagctcacggactacggcatgtgcaaggaaggc
ctgggccccggcgacacgaccagcactttctgtgggaccccaaattacatcgccccagaa
atcctgcggggagaagagtacgggttcagcgtggactggtgggcgctgggcgttctcatg
tttgagatgatggccgggcgctcccccttcgacatcatcaccgacaaccctgacatgaac
acggaggactaccttttccaagtcatcctggagaagccgatccggatcccccggttcctg
tccgtcaaggcctcccacgtcttgaaaggctttttaaacaaggaccccaaagagaggctt
ggttgccggccacagactggtttttctgacatcaaatctcacgcgtttttccgcagcata
gactgggacctgctggagaagaagcaggcgctgcccccgttccagccacagatcacggac
gactacggcctggacaactccgacacgcagttcaccagcgagcctgtgcagctgacccca
gacgacgaggacgtcatcaagaggatcgaccagtccgagttcgaaggcttcgagtacatc
aacccactcctgctctccactgaggagtccgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100348584
Entry
100348584         CDS       T03373                                 
Symbol
PRKCI, PRKC1
Name
(RefSeq) protein kinase C iota
  KO
K06069  atypical protein kinase C iota type [EC:2.7.11.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04144  Endocytosis
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04910  Insulin signaling pathway
ocu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100348584 (PRKCI)
   04390 Hippo signaling pathway
    100348584 (PRKCI)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100348584 (PRKCI)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100348584 (PRKCI)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100348584 (PRKCI)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100348584 (PRKCI)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100348584 (PRKCI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100348584 (PRKCI)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100348584 (PRKCI)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100348584 (PRKCI)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like Kdo APH C1_2 ABC1 Haspin_kinase
Other DBs
NCBI-GeneID: 100348584
NCBI-ProteinID: XP_002716448
Ensembl: ENSOCUG00000014563
UniProt: G1T7N4
LinkDB
Position
14:65132671..65224873
AA seq 596 aa
MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSF
DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPPEPMMPLDQSSMHSDHPQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgccgacccagagggacagcagcaccatgtcccacacggtcgcaggcggcggcagcggg
gaccattctcaccaggtccgagtgaaagcttactaccgtggggatatcatgataacacat
tttgaaccttccatctcctttgaaggcctttgcagtgaggttcgagatatgtgttctttc
gacaatgaacagctttttaccatgaaatggatagatgaggaaggagacccgtgtacagta
tcatctcagttggagttagaagaagcctttaggctttatgaactaaacaaggattctgaa
ctcttgattcatgtattcccttgtgtaccagaacgtcctggaatgccttgtccaggagag
gataaatccatctaccgcagaggtgcccgccgctggagaaagctttactgtgcaaatggt
catacgtttcaagccaagaggttcaataggcgtgctcactgtgctatctgcacggaccga
atatggggacttggacgccagggatataagtgcatcaactgcaagctgctggttcataag
aagtgccacaaactcgtcacaattgaatgtggacggcattctttgccaccggaaccaatg
atgcctttggaccagtcatccatgcattcggaccaccctcagacagtaattccatataat
ccttcaagtcatgagagtttggaccaagttggtgaagaaaaggaggcaatgaacaccagg
gaaagtggcaaagcttcatccagcttaggtcttcaggattttgatttgctccgagtaata
ggaagaggaagctatgccaaagtactgttggttcgattaaaaaaaacagatcgtatttat
gcaatgaaagttgtcaaaaaagagcttgtcaatgatgacgaggatattgactgggtacag
acagagaaacacgtttttgagcaagcatctaatcatccttttctggttggactgcattcc
tgctttcagacagaaagcaggttgttctttgtcatagagtatgtaaatggaggagatcta
atgtttcacatgcagcgacaacgaaaacttcctgaggaacatgccagattttactctgca
gaaatcagtctagcattaaattatcttcatgagcgaggcataatttatagagatttgaag
ttggataatgtattactggactctgaagggcacattaaactcactgactatggcatgtgt
aaggagggattacggccaggagatacaaccagcactttctgtggtactcctaattacatt
gctcctgaaattttaagaggagaagactatggtttcagtgtcgactggtgggctctgggc
gtattaatgtttgagatgatggcaggaaggtctccgtttgatattgttgggagctctgat
aaccctgatcaaaacacagaggattatctcttccaagttattttggaaaaacaaattcgt
ataccacgttccctatctgtaaaagctgcaagtgtcctgaagagttttctcaacaaggac
ccaaaggaacgattaggttgtcatcctcaaacaggatttgctgatattcagggacaccca
ttcttccgaaatgttgactgggatatgatggagcaaaagcaagtggtgcctccttttaaa
ccaaatatttctggggaatttggtttggacaattttgattctcagtttactaatgaacct
gtgcagctcacaccggatgatgatgacattgtgaggaagattgatcagtcggaatttgaa
gggttcgagtacatcaaccctctgttgatgtctgcagaagaatgcgtctaa

KEGG   Oryctolagus cuniculus (rabbit): 103347148
Entry
103347148         CDS       T03373                                 
Name
(RefSeq) protein kinase C zeta type
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04144  Endocytosis
ocu04360  Axon guidance
ocu04390  Hippo signaling pathway
ocu04530  Tight junction
ocu04611  Platelet activation
ocu04910  Insulin signaling pathway
ocu04926  Relaxin signaling pathway
ocu04930  Type II diabetes mellitus
ocu04931  Insulin resistance
ocu04933  AGE-RAGE signaling pathway in diabetic complications
ocu05165  Human papillomavirus infection
ocu05415  Diabetic cardiomyopathy
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    103347148
   04390 Hippo signaling pathway
    103347148
   04071 Sphingolipid signaling pathway
    103347148
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103347148
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103347148
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    103347148
   04062 Chemokine signaling pathway
    103347148
  09152 Endocrine system
   04910 Insulin signaling pathway
    103347148
   04926 Relaxin signaling pathway
    103347148
  09158 Development and regeneration
   04360 Axon guidance
    103347148
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    103347148
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    103347148
   05415 Diabetic cardiomyopathy
    103347148
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    103347148
   04931 Insulin resistance
    103347148
   04933 AGE-RAGE signaling pathway in diabetic complications
    103347148
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    103347148
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     103347148
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   103347148
SSDB
Motif
Pfam: C1_1 PB1 C1_2 PHD_2
Other DBs
NCBI-GeneID: 103347148
NCBI-ProteinID: XP_008251837
LinkDB
Position
Un
AA seq 168 aa
MCGLHQHHPLTLKWVDSEGDPCTVSSQMELGEAFRLAGQHRDDGLILHVFPSTPEQPGMP
CPGEDKSIYRRGARRWRKLYRANGHLFQAKRFNRRAYCGHGSERIWGLARQGYRCINCKL
LVHKRCHGLVPLTCRRHMDSVMPSQEPPVADKSDDADLPSQETDGIAF
NT seq 504 nt   +upstreamnt  +downstreamnt
atgtgcggcctgcaccagcaccaccccctcaccctcaagtgggtggacagcgaaggtgac
ccttgcacggtgtcctcgcagatggagctgggggaggccttccgcctggccggccagcac
agggacgacgggctcatccttcacgtgttccccagcacgccggagcagccaggcatgccg
tgtcccggggaagacaaatccatctaccgccgcggagccagaagatggaggaagctgtac
cgtgccaacggccatctcttccaagccaagcgctttaacaggagagcgtactgtggccac
ggaagcgaaaggatatggggtctcgcaaggcagggctacaggtgcatcaactgcaaactg
ctggtgcataagcgttgccacggcctcgtcccgctgacctgcaggaggcatatggattct
gtcatgccttcgcaagagcctccagtagccgacaagagcgacgacgcggaccttccttcc
caggagactgacggaatcgctttc

DBGET integrated database retrieval system