KEGG   Oryctolagus cuniculus (rabbit): 100009569
Entry
100009569         CDS       T03373                                 
Symbol
BMP4, BMP-4
Name
(RefSeq) bone morphogenetic protein 4
  KO
K04662  bone morphogenetic protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04350  TGF-beta signaling pathway
ocu04390  Hippo signaling pathway
ocu04550  Signaling pathways regulating pluripotency of stem cells
ocu04919  Thyroid hormone signaling pathway
ocu05200  Pathways in cancer
ocu05217  Basal cell carcinoma
ocu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100009569 (BMP4)
   04390 Hippo signaling pathway
    100009569 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100009569 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100009569 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100009569 (BMP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009569 (BMP4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    100009569 (BMP4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009569 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100009569 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100009569 (BMP4)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   100009569 (BMP4)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Morphogens
   100009569 (BMP4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 100009569
NCBI-ProteinID: NP_001182652
Ensembl: ENSOCUG00000011097
UniProt: G1T0L5
LinkDB
Position
17:complement(72720947..72723098)
AA seq 409 aa
MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEAT
LLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQMPSGGLEYPERPASRANTVRS
FHHEEHLENIPGTSENSAFRFLFNLSSIPENEAISSAELRLFREQVDQGPDWERGFHRIN
IYEVMKPPAEAVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNHGLAVEVT
HLHHTRTHQGQHVRVSRSLPQGSGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQ
RARKKNKNCRRHALYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQT
LVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgattcctggtaaccgaatgctgatggtcgttttattatgccaagtcctgttaggaggc
gcgagccatgctagtttgatacctgagacggggaagaaaaaagtcgccgagattcagggc
cacgcgggaggacgccgctcagggcagagccatgagctcctgcgggacttcgaggcgacg
ctgctgcagatgttcgggctgcgccgccgcccgcagcctagcaagagcgccgtcatcccg
gattacatgcgggatctttaccggctccagtcaggggaggaggaggaggaagagcagatg
cccagcggcggtctcgagtatccggagcgtccggccagccgggccaacaccgtgaggagc
ttccaccacgaagaacatctggagaacatcccagggaccagcgaaaactctgcttttcgt
ttcctctttaacctcagcagcatcccagagaacgaggccatctcctccgcagagctccgg
ctcttccgggagcaggtggaccagggccctgactgggagcggggcttccaccggataaac
atttatgaggttatgaagcccccggcggaagcggtgcccgggcacctcatcacacgacta
ctggacacgagactggtccaccacaatgtgacacggtgggaaacttttgacgtgagcccc
gcggtcctgcgatggacccgggagaagcagcccaaccatgggctggccgtggaggtgact
cacctccaccatacacggacccatcagggccagcatgtcagggttagccgatcgttacct
caagggagtggggattgggcccagctccggcccctcctggtcacctttggccacgacggc
cggggccatgccttgacccgacgccggagggccaagcggagccctaagcatcacccacag
cgggcccggaagaagaataagaactgccggcgccacgcgctctacgtggacttcagcgac
gtgggctggaatgactggattgtggcccccccaggctaccaggccttctactgccacggg
gactgcccctttccactggcggaccacctcaactccaccaaccacgccatcgtgcagacc
ctggtcaactctgtcaactccagcatccccaaagcctgttgtgtgcccactgaactgagc
gccatctccatgctgtacctggatgagtatgacaaggtggtactgaagaattaccaggag
atggtagtagaggggtgtgggtgccgctga

DBGET integrated database retrieval system