KEGG   Oryctolagus cuniculus (rabbit): 100009589
Entry
100009589         CDS       T03373                                 
Symbol
LY96
Name
(RefSeq) lymphocyte antigen 96
  KO
K05400  lymphocyte antigen 96
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04936  Alcoholic liver disease
ocu05132  Salmonella infection
ocu05133  Pertussis
ocu05145  Toxoplasmosis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100009589 (LY96)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100009589 (LY96)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100009589 (LY96)
   05133 Pertussis
    100009589 (LY96)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100009589 (LY96)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100009589 (LY96)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100009589 (LY96)
SSDB
Motif
Pfam: E1_DerP2_DerF2
Other DBs
NCBI-GeneID: 100009589
NCBI-ProteinID: NP_001076256
Ensembl: ENSOCUG00000000965
UniProt: Q8MIQ1
LinkDB
Position
3:89728214..89773408
AA seq 160 aa
MFTFMVFSTLISSIFTEPGKLHWVCKSADATVSYTYCDNMEIPISINVEPCITLKGTQGL
LHIFYIPRRDMNQLYLNLYISVNSMDLPKRKEIICKGSDDVYSFCRALKGETVNTTVPFS
FKGIRLSKGQYRCVVEAIAGSAEEMIFCLNFTIIHNPRVN
NT seq 483 nt   +upstreamnt  +downstreamnt
atgttcacatttatggttttttctaccctgatttcttccatatttactgaacctgggaag
ctacattgggtctgcaaatctgctgatgcaactgtttcatacacctactgtgataacatg
gaaatccctatttcaattaatgttgagccctgtataacactgaagggaacccaaggttta
ttgcatattttctacattccaaggagagacatgaatcaattatatttgaatctctatata
tctgtcaactccatggatttgccaaagcgcaaagaaattatctgcaaaggatctgatgat
gtgtattctttctgcagagctctgaagggagagactgtgaatacaacagtaccattttcc
ttcaagggcatacggctttctaagggacaatacagatgtgttgtagaagccatagctggg
agtgctgaagaaatgatcttttgcttgaattttaccatcatacacaacccacgtgtcaat
tag

DBGET integrated database retrieval system