KEGG   Oryctolagus cuniculus (rabbit): 100037713
Entry
100037713         CDS       T03373                                 
Symbol
CLDN1
Name
(RefSeq) claudin 1
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100037713 (CLDN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100037713 (CLDN1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100037713 (CLDN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100037713 (CLDN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100037713 (CLDN1)
   04147 Exosome [BR:ocu04147]
    100037713 (CLDN1)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100037713 (CLDN1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100037713 (CLDN1)
  Exosomal proteins of colorectal cancer cells
   100037713 (CLDN1)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Voltage_CLC SUR7 DUF6336 CD20 ThrE YccF
Other DBs
NCBI-GeneID: 100037713
NCBI-ProteinID: NP_001082785
Ensembl: ENSOCUG00000011464
UniProt: A0ST56
LinkDB
Position
14:complement(85973665..85988953)
AA seq 202 aa
MASMGLQVMGFILAFLGWIGSIVSTALPQWKIYSYAGDSIVTAQAIYEGLWMSCVSQSTG
QIQCKVFDSLLNLNSTLQATRALMVIGILLGLIAIFVATVGMKFMKCMEDDEEQKMRMAV
IGGVIFLISGLATLVATAWYGNRIVQEFYDPLTPVNSRYEFGQALFTGWAAASLCLLGGA
LLCCSCPRKTTSYPVPAAPWTP
NT seq 609 nt   +upstreamnt  +downstreamnt
atggcgtctatggggctgcaggtcatgggcttcatcctggccttcctgggttggatcggc
tccatcgtcagcaccgccctgcctcaatggaagatttactcctatgccggcgacagcatc
gtgaccgcccaagccatctacgaggggctatggatgtcttgtgtgtcgcagagcaccggg
cagatccagtgcaaagtcttcgactctttgctgaatctcaacagtactttgcaagcaacc
cgtgccttgatggtgattggcatcctgctgggactgatagcaatctttgtggccactgtt
ggaatgaagtttatgaagtgcatggaagatgatgaggagcaaaagatgcggatggctgtc
attgggggtgtgatatttcttatttcaggtctggctactttagttgccacagcatggtat
ggcaacagaattgttcaagaattctatgaccctttgacccctgtcaattcaaggtatgaa
ttcggtcaggctcttttcactggctgggctgctgcttctctctgccttctgggaggtgcc
ctactttgctgttcttgtcctcggaaaaccacctcttacccagtacctgcagccccatgg
acgccataa

KEGG   Oryctolagus cuniculus (rabbit): 100337855
Entry
100337855         CDS       T03373                                 
Symbol
CLDN9
Name
(RefSeq) claudin 9
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100337855 (CLDN9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100337855 (CLDN9)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100337855 (CLDN9)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100337855 (CLDN9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100337855 (CLDN9)
   04147 Exosome [BR:ocu04147]
    100337855 (CLDN9)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100337855 (CLDN9)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100337855 (CLDN9)
  Exosomal proteins of colorectal cancer cells
   100337855 (CLDN9)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM_230_134
Other DBs
NCBI-GeneID: 100337855
NCBI-ProteinID: XP_008248849
LinkDB
Position
Un
AA seq 217 aa
MASAGLELLGMTLAVLGWLGTLVSCALPLWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVAITGAQCTTCVEDEGAKARIVLT
AGVILLLAGILVLIPVCWTAHAVIQDFYNPLVAEALKRELGASLYLGWAAAALLMLGGGL
LCCTCPPPQLERPRGPRLGYSIPSRSGASGLDKRDYV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgtccgctggcctggagctcttgggcatgaccctggccgtactgggctggctgggg
accctggtgtcctgcgccctgccgctctggaaagtgaccgccttcatcggcaacagcatc
gtggtggcccaggtggtgtgggaggggctgtggatgtcctgtgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggccgcc
cgcgccctctgcgtcgtcgccctcctgctggccctgctcggcctgctggtggccatcacc
ggtgcccagtgcaccacgtgcgtggaggatgagggtgccaaggcccgcatcgtgctcacg
gcgggggtcatcctcctcctggcgggcatcctggtgctcatccccgtctgctggacagct
cacgctgtcatccaggacttctacaacccgctggtggccgaggccctcaaacgagagctg
ggggcctccctctacctgggctgggcagcggcggctctgcttatgctgggtggggggctc
ctctgctgcacctgccccccgccccagctggagcggccccgcggccctcggctgggctac
tccattccgtcccgctcgggtgcttcggggctggacaagagggactacgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100338591
Entry
100338591         CDS       T03373                                 
Symbol
CLDN7
Name
(RefSeq) claudin 7
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100338591 (CLDN7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100338591 (CLDN7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100338591 (CLDN7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100338591 (CLDN7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100338591 (CLDN7)
   04147 Exosome [BR:ocu04147]
    100338591 (CLDN7)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100338591 (CLDN7)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100338591 (CLDN7)
  Exosomal proteins of colorectal cancer cells
   100338591 (CLDN7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin SUR7 Clc-like
Other DBs
NCBI-GeneID: 100338591
NCBI-ProteinID: XP_002718859
Ensembl: ENSOCUG00000007002
UniProt: G1SS67
LinkDB
Position
19:11880845..11883111
AA seq 211 aa
MANSGLQLLGFSMALLGWVALVASTAIPQWQMSSYAGDNIITAQAMYKGLWMECVTQSTG
MMSCKMYDSVLALSGALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM
SGGIVFIVAGLAALIACSWYGHQIVTDFYNPLTPMNVKYEFGSAIFIGWAGSALVLLGGA
LLSCSCPGSENKSAYRAPRSYPKSNSAKEYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaattcgggcctgcagttgctcggcttttctatggctcttctgggatgggtggcc
ctggtggcgagcaccgccatcccgcagtggcagatgagctcgtacgcgggcgacaacatt
atcacggcccaggccatgtacaaggggctgtggatggagtgcgtcacgcagagcaccggc
atgatgagctgcaaaatgtacgactctgtgctcgccctgtccggggccttgcaggccact
cgagccctcatggtggtatctctggtgctgggcttcctggccatgtttgtggccacgatg
ggcatgaagtgtacgcgctgtgggggagatgacaaagtgaagaaggcccgcattgccatg
tctggaggcatcgtcttcatcgtggcaggtcttgctgccttgatagcttgttcctggtat
ggtcatcagattgtcacagacttttataaccccctgacccccatgaatgttaagtacgag
tttggttctgccatttttattggctgggcagggtctgctctggtcctcctgggaggcgcg
ctgctctcctgctcctgccctggcagtgagaacaaatctgcgtaccgtgcacctcgctcc
taccccaagtccaactctgccaaggagtacgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100340730
Entry
100340730         CDS       T03373                                 
Symbol
CLDN22
Name
(RefSeq) claudin 22
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100340730 (CLDN22)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100340730 (CLDN22)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100340730 (CLDN22)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100340730 (CLDN22)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100340730 (CLDN22)
   04147 Exosome [BR:ocu04147]
    100340730 (CLDN22)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100340730 (CLDN22)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100340730 (CLDN22)
  Exosomal proteins of colorectal cancer cells
   100340730 (CLDN22)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100340730
NCBI-ProteinID: XP_017193845
Ensembl: ENSOCUG00000017000
UniProt: G1U3F2
LinkDB
Position
2:complement(60662830..60663492)
AA seq 220 aa
MALVFRTAAQFAGISLSLLGWILSCLTNYLPLWKNLNLDLNEMEHWTLGLWQTCVVQEEV
GTQCKGFDSFLALPAELRIARIFMFLCNGLGFLGLLVSGSGLDCLRIGESQQELKKRLLV
LGGILSWTSGITALVPVSWVAHVTVQEFWDETLPEIVPRWEFGEALFLGWGAGFSLLVGG
CLLHCAACSARAPLAAGHYAVADLQALRQQLPMKNSNLKV
NT seq 663 nt   +upstreamnt  +downstreamnt
atggctttagtatttagaactgcagcacagtttgctggaatttcactatctttactggga
tggattttatcctgtcttacgaactacctgccactctggaagaacctcaacctggactta
aatgagatggaacactggaccctgggactctggcagacttgtgtcgtccaggaggaagtg
ggcacgcagtgcaagggcttcgactctttcctggctttgcctgctgaactccggatcgcc
aggattttcatgtttctgtgcaacgggctggggttcctgggcctgctggtctcggggtct
ggcctggactgcttgagaatcggagagagccagcaagagctcaagaagcgcctgctcgtc
ctggggggaatcctgtcctggacgtcaggcatcacagccctggtgccggtctcgtgggtg
gcccacgtgacggtccaggagttctgggacgagacccttccggagattgtgccccggtgg
gagtttggggaggccctgttcctgggctggggtgctggcttctccctcctcgtgggaggg
tgtctgcttcactgtgcagcctgctccgcccgggctccgctcgctgccggccactacgcg
gtggcagacttgcaagctcttcgtcaacaactgcccatgaaaaactccaacctgaaagtc
taa

KEGG   Oryctolagus cuniculus (rabbit): 100340963
Entry
100340963         CDS       T03373                                 
Symbol
CLDN4
Name
(RefSeq) claudin 4
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100340963 (CLDN4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100340963 (CLDN4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100340963 (CLDN4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100340963 (CLDN4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100340963 (CLDN4)
   04147 Exosome [BR:ocu04147]
    100340963 (CLDN4)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100340963 (CLDN4)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100340963 (CLDN4)
  Exosomal proteins of colorectal cancer cells
   100340963 (CLDN4)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4131
Other DBs
NCBI-GeneID: 100340963
NCBI-ProteinID: XP_008247312
Ensembl: ENSOCUG00000010358
UniProt: G1SZ42
LinkDB
Position
Un
AA seq 209 aa
MASMGLQVMGIALAVLGWLGSMLCCAMPMWRVTAFIGSNIVTSQVIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALTIICIIVAALGVLLSVVGGKCTNCVEDETAKAKTMIV
AGVVFLLAGLLVMVPVSWTAHNVIRDFYNPLVANGQKREMGASLYIGWAASGLLLLGGAL
LCCNCPPRNDKPYSAKYSAARSAPASNYV
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcttctatgggactgcaggtgatggggatcgccctggccgtgctgggctggctgggc
tccatgctgtgctgcgccatgcccatgtggcgggtgacggccttcatcggcagcaacatc
gtcacctcgcaggtcatctgggaagggctgtggatgaactgtgtggtgcagagcacgggg
cagatgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcc
cgcgcgctcaccatcatctgcattatcgtggccgccctgggcgtgctgctgtccgtggtc
gggggcaagtgcaccaactgcgtggaggatgagacggccaaggccaagaccatgatcgtg
gcaggcgtggtgttcctgctggccggcctgctggtgatggtgcccgtgtcgtggacggcc
cacaacgtcatccgggacttctacaatccgctcgtggcgaacgggcagaagcgcgagatg
ggcgcctccctctacatcggctgggcggcctccggcctgctgctgctcggcggggctctg
ctgtgctgtaactgcccgccgcgcaacgacaaaccctactcggccaagtactcggctgcc
cgctccgccccggccagcaactacgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100341067
Entry
100341067         CDS       T03373                                 
Symbol
CLDN25
Name
(RefSeq) claudin 25
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100341067 (CLDN25)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100341067 (CLDN25)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100341067 (CLDN25)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100341067 (CLDN25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100341067 (CLDN25)
   04147 Exosome [BR:ocu04147]
    100341067 (CLDN25)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100341067 (CLDN25)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100341067 (CLDN25)
  Exosomal proteins of colorectal cancer cells
   100341067 (CLDN25)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100341067
NCBI-ProteinID: XP_002708472
Ensembl: ENSOCUG00000025517
UniProt: G1TTU2
LinkDB
Position
1:complement(102607670..102608756)
AA seq 229 aa
MAWSFCGKVQLGGLLLSLFGWVCSCVSTALPQWKTLNLELNEMETWIMGLWEACVTQEEV
ATVCKAFESFLSLPLELQVSRILMVASHVLGLLGLLLSACGLECFQFHKMKWVCKRQLCL
LGGTLEVSASATTLFPVSWVAYGTIRDFWDDSVPEIVPRWEFGDALFLGWAAGVGLALGG
LLLIFSACLGKEDVPSPWLAGPTAPPLCAPMQDSDGSFHLTPRPRSLVI
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcctggagcttctgtggcaaagtccagcttggaggactgctgctctctctctttggc
tgggtctgctcatgcgtcagcaccgccctgccccagtggaagactctcaatctggaactg
aacgagatggagacctggatcatggggctctgggaggcctgcgtgactcaggaggaggtc
gccactgtgtgcaaggcctttgagtccttcctgtctctgcccctggagctccaggtatcc
cgcatcctcatggtagcctcccacgtgctgggactgctggggcttctcctctctgcctgt
gggttggaatgcttccagtttcacaagatgaaatgggtttgcaagaggcagctttgcctt
ttgggagggaccttggaggtatcagcttcagccaccaccctctttccagtctcctgggtg
gcctacggcacgatccgagacttctgggatgacagtgtgcctgagattgtgcctcggtgg
gagtttggagatgccctcttcctgggctgggctgctggggttggccttgctcttggtgga
ctactcctcatcttctcagcctgcctggggaaagaagatgtaccttctccctggctggct
gggcccacagcccctccactctgtgctcccatgcaggactcagacggctccttccacctc
acaccaagacctaggagcctggtcatctag

KEGG   Oryctolagus cuniculus (rabbit): 100341220
Entry
100341220         CDS       T03373                                 
Symbol
CLDN3
Name
(RefSeq) claudin 3
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100341220 (CLDN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100341220 (CLDN3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100341220 (CLDN3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100341220 (CLDN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100341220 (CLDN3)
   04147 Exosome [BR:ocu04147]
    100341220 (CLDN3)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100341220 (CLDN3)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100341220 (CLDN3)
  Exosomal proteins of colorectal cancer cells
   100341220 (CLDN3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37
Other DBs
NCBI-GeneID: 100341220
NCBI-ProteinID: XP_002722008
LinkDB
Position
Un
AA seq 219 aa
MSMGLEITGTSLAVLGWLGSIVCCALPMWRVSAFIGSSIITAQIIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLFVALVGAQCTNCVQDETAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIQDFYNPLVPEAQKREMGAGLYVGWAASALQLLGGALL
CCSCPPRDKYATTKIAYSAPRSAGPGTTAGTAYDRKDYV
NT seq 660 nt   +upstreamnt  +downstreamnt
atgtctatgggcctggagatcaccggcacgtcgctggccgtgctgggctggctgggctcc
atcgtgtgctgcgcgctgcccatgtggcgcgtgtccgccttcatcggcagcagcatcatc
acggctcagatcatctgggaggggctgtggatgaactgtgtggtgcagagcacggggcag
atgcagtgcaaggtgtacgactcgctgctggcgctgccgcaggacctgcaggcggcccgc
gccctcatcgtcgtggccatcctgctggccgccttcgggctcttcgtggcgctcgtgggt
gcccagtgcaccaactgcgtgcaggacgaaacagccaaggccaagatcaccatcgtggcg
ggcgtgctcttcctgctggccgcgctgctcaccctcgtgccagtgtcctggtcggccaac
accatcatccaggacttctacaacccgctggtgcccgaggcgcagaagcgcgagatgggc
gccggcctgtacgtgggctgggccgcctcggcgctgcagctgctggggggcgcgctgctc
tgctgctcctgcccgccgcgcgacaagtacgcgaccaccaagatcgcctactcggcgccg
cgctccgccgggcccggcacgaccgcgggcaccgcctacgaccgcaaggactacgtctga

KEGG   Oryctolagus cuniculus (rabbit): 100342165
Entry
100342165         CDS       T03373                                 
Symbol
CLDN6
Name
(RefSeq) claudin 6
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100342165 (CLDN6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100342165 (CLDN6)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100342165 (CLDN6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100342165 (CLDN6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100342165 (CLDN6)
   04147 Exosome [BR:ocu04147]
    100342165 (CLDN6)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100342165 (CLDN6)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100342165 (CLDN6)
  Exosomal proteins of colorectal cancer cells
   100342165 (CLDN6)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 100342165
NCBI-ProteinID: XP_002722826
Ensembl: ENSOCUG00000017197
UniProt: G1TD67
LinkDB
Position
Un
AA seq 221 aa
MASVGLQILGIVLTLLGWVNALVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTG
QMQCKVYDSLLALPQDLQAARALCVVALLLALLGLLVYLAGAKCTTCVEDKDSKARLVLT
SGITFIISGILTLIPVCWTAHTIIQDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGL
LCCTCPSGGSRGSSHYMARYSASGPNAASRGPSEYPTKNYV
NT seq 666 nt   +upstreamnt  +downstreamnt
atggcctccgtcggtctgcagatcctggggatcgtcctgacactgctgggctgggtgaat
gccctggtgtcctgcgccctgcccatgtggaaggtgaccgccttcatcggcaacagcatc
gtggtggcccaggtggtgtgggaggggctgtggatgtcctgtgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcgctgctggcgctgccccaggacctgcaggccgcc
cgcgccctctgcgtcgtcgccctcctgctggccctgctgggtttgctggtctacctcgct
ggggccaagtgcaccacgtgtgtggaggacaaggactccaaggcccgcctggtgctcacc
tccgggatcacctttatcatttcggggatcctgaccctgatccccgtctgctggacggcc
cacaccatcatccaggacttctacaacccgctggtggccgaggcgcagaagagagagctg
ggggcctcgctctacctgggctgggcagcctcgggccttttgttgctgggtggggggctg
ctgtgctgcacctgcccctctggggggtcccggggctccagccattacatggcccgctac
tcagcgtctggcccgaatgctgcctcccgagggccctctgagtaccccacgaagaattac
gtctga

KEGG   Oryctolagus cuniculus (rabbit): 100346496
Entry
100346496         CDS       T03373                                 
Symbol
CLDN14
Name
(RefSeq) claudin 14
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100346496 (CLDN14)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100346496 (CLDN14)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100346496 (CLDN14)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100346496 (CLDN14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100346496 (CLDN14)
   04147 Exosome [BR:ocu04147]
    100346496 (CLDN14)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100346496 (CLDN14)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100346496 (CLDN14)
  Exosomal proteins of colorectal cancer cells
   100346496 (CLDN14)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin
Other DBs
NCBI-GeneID: 100346496
NCBI-ProteinID: XP_002721303
Ensembl: ENSOCUG00000014024
UniProt: G1TJ18
LinkDB
Position
Un
AA seq 236 aa
MASTAVQLLGFLLSFLGLVGTLITTILPHWRRTAHVGTNILTAVSYLKGLWMECVWHSTG
IYQCQVYRSLLALPRDLQAARALMVISCLLAGAACACAVVGMKCTRCAKGTPAKAAMAVL
GGALFMLSGLLCMVAVSWTANDVVQNFYNPLLPSGMKFELGQALYLGFISSSLSLIGGTL
LCLSCQDQEPRRPSRAQPRPILASAPTYQPPAAYKDNRAPSVTSATHSGYRLNDYV
NT seq 711 nt   +upstreamnt  +downstreamnt
atggccagcacggccgtgcagctcctgggcttcctgctcagcttcctgggcctggtgggc
acactcatcaccaccatcctcccgcactggcggcgcacggcgcacgtgggcaccaacatc
ctgacggccgtgtcctacctgaaggggctgtggatggagtgtgtgtggcacagcaccggc
atctaccagtgccaggtctaccgctcgctgctggcgctgccgcgcgacctgcaggcggcc
cgcgcgctcatggtcatctcgtgcctgctggccggtgccgcctgcgcctgcgccgtcgtg
ggcatgaagtgcacgcgctgcgccaagggcacaccggccaaggccgcgatggccgtgctg
ggcggcgcactcttcatgctgtccggtctgctctgcatggtggccgtgtcctggacggcc
aacgacgtggtgcagaacttctacaaccctctcctgcccagcggcatgaagttcgagctg
ggccaggcgctctacctgggcttcatctcctcgtcgctgtcgctcatcgggggtaccctg
ctctgcctctcctgccaggaccaggagccccggcggccctcccgggcgcaaccccggccc
atcttggcgtcggcgcccacctaccagcccccagccgcctacaaggacaaccgcgcccca
tccgtgacctcggcgacacacagcgggtacagactgaacgactacgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100349260
Entry
100349260         CDS       T03373                                 
Symbol
CLDN18
Name
(RefSeq) claudin 18
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100349260 (CLDN18)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100349260 (CLDN18)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100349260 (CLDN18)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100349260 (CLDN18)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100349260 (CLDN18)
   04147 Exosome [BR:ocu04147]
    100349260 (CLDN18)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100349260 (CLDN18)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100349260 (CLDN18)
  Exosomal proteins of colorectal cancer cells
   100349260 (CLDN18)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100349260
NCBI-ProteinID: XP_017202156
LinkDB
Position
14:31671229..31708773
AA seq 438 aa
MAVTACQGLGFVVSLIGFAGIIAATCMDQWSTQDLYNNPVTAVYNYQGLWRSCVRESSGF
TECRGYFTLLGLPESISHKEPDCGHSVLGSSVPVGTGATGCHVPARLPHGLHKEYVFVCL
MRKLRHRETEHGGSKWQGEDSNPADSPEPELFSIARAPRSPRARRAHTLAAAGRLRPCPP
PRTQVVGFLLAALGLAGCIAATGMDTWSTQDLYDNPVTSVFQYEGLWRSCVRQSSGFTEC
RPYFTILGLPAMLQAVRALMVVGIVLGAFGILVSIFALKCIRIGSMEDSAKANMTLTSGV
IFIISGLCAIVGVSVFANMLVTNFWMSTANMYSGMGGMVQTVQTRYTFGAALFVGWVAGG
LTLIGGVMMCIACRGLAPNETNYKAVSYHASGHNVAYKPGGFKASTAFGSNTRNKKIYDG
GAHGEDEVQSHPSKYDYV
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggccgtgaccgcctgccaaggcctggggttcgtggtttcactgatcgggtttgcgggc
attattgctgccacctgcatggaccaatggagcacgcaggacttgtacaacaacccagtg
acagccgtgtacaactaccaagggctgtggcgctcctgcgtccgggagagctctggcttc
accgagtgccgcggctacttcaccctgctggggctgccagaaagtatcagtcacaaggag
ccagactgcgggcactctgtgctcgggtcctctgtgccagtgggaacaggtgctacaggc
tgccatgtccctgcccggctgccacacgggctgcacaaagaatatgtgttcgtttgctta
atgaggaaactgaggcacagagagactgagcacggtggtagtaagtggcagggtgaagac
tcaaacccagccgactctccagagcccgagctcttctccattgcgagagcgccgcgctcc
cctcgggcgcgccgggcgcacaccttggcggctgcagggcggctgaggccatgtccacca
ccgcgtacccaagtggtgggcttcctcctggccgccctggggctggcgggctgcatcgcc
gccacgggcatggacacgtggagcacccaggacctgtacgacaaccctgtcacctccgtg
ttccagtacgaagggctctggaggagctgcgtgaggcagagctccgggttcaccgagtgc
cggccctacttcaccatcctgggcctcccagccatgctgcaggcggtacgggctctgatg
gtcgtgggcatcgtcctcggtgcctttggcatcctggtgtccatcttcgccctgaaatgc
attcgtattggcagcatggaggactctgccaaggccaacatgacgctgacctccggagtc
atattcatcatctcaggtctgtgtgcaattgttggagtgtccgtgttcgccaacatgctc
gtcactaacttctggatgtccacagctaatatgtacagtggcatgggtgggatggtgcag
acagttcagaccaggtacacctttggtgcagctttgttcgtgggctgggtggctggaggc
ctcaccctaattggaggtgtcatgatgtgcatcgcctgccggggcctggcccctaatgaa
accaactacaaagccgtatcttaccacgcctcgggccacaacgtggcctacaagccagga
ggcttcaaggccagcactgcctttggatccaacaccagaaacaagaagatttatgatggg
ggtgcccacggagaggatgaggtacaatctcatccttccaagtacgactacgtgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100350530
Entry
100350530         CDS       T03373                                 
Symbol
CLDN23
Name
(RefSeq) claudin 23
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100350530 (CLDN23)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100350530 (CLDN23)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100350530 (CLDN23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100350530 (CLDN23)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100350530 (CLDN23)
   04147 Exosome [BR:ocu04147]
    100350530 (CLDN23)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100350530 (CLDN23)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100350530 (CLDN23)
  Exosomal proteins of colorectal cancer cells
   100350530 (CLDN23)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Yip1 TMEM_230_134
Other DBs
NCBI-GeneID: 100350530
NCBI-ProteinID: XP_008272287
Ensembl: ENSOCUG00000000632
UniProt: G1SDQ8
LinkDB
Position
Un
AA seq 298 aa
MRTPVVMTLGMVLAPCALLLNLTSTLAPGWRLVKGFLDQPVDVVQFQGLWDLCREQSSRE
RECGQPDEWGYFAAQPVLVARGLMVTSLATTALGLLLATLGVRCWRDEPHFALAGLSGIV
FFAAGLFSLIPVSWYNHFLADRTVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALS
LAPWCEERCQGCRKAPPAGPRRSSISTVYVDWPEPALTPAIKYYSEGQHRPPPAAQQQHG
AAAKPRVGFPMPKPRLQTCYTNPVDVLDGESHKAADSQGASSRSTRPCHSSLPCDSDL
NT seq 897 nt   +upstreamnt  +downstreamnt
atgcggacgccggtggtgatgacgctgggcatggtgctggcgccctgcgcgctgctgctc
aacctgaccagcacgctggcacccggctggcggctggtgaagggcttcctggaccagccg
gtggacgtggtgcagttccagggcctgtgggacttgtgccgcgagcagagcagccgcgag
cgcgagtgcggccagcccgacgagtggggctacttcgccgcccagccggtgctcgtggcc
cggggtctcatggtcacgtcgctggccaccacggccctggggctgctgctggccacgctg
ggcgtgcggtgctggcgggacgagccccacttcgcgctggccggcctctcgggcatcgta
ttcttcgccgccggcctcttcagcctcatcccggtctcctggtacaaccacttcttggcg
gaccgcaccgtcctgcccgccccggccagcccggtcacggtgcaggtcagctacagcctg
gtgctgggatacctgggcagctgcctgctgctgctggggggcttctcgctggcgctcagc
ttggcgccctggtgcgaggaacgctgccagggctgccgcaaggcgcctcccgccggcccg
cgccgcagtagcatcagcaccgtctacgtggactggccagagcccgcactcacgcccgcc
atcaagtactacagcgaaggccagcaccggccgccgccggccgctcagcagcagcacggc
gcggcggccaagcccagggtcggcttccccatgccgaagccgcggctgcagacctgctac
accaacccggtggacgtgctggacggcgagagccacaaggcagccgactcccagggcgcc
tcgtcgcgcagcacccggccctgccacagctcgctgccctgtgactccgacctgtag

KEGG   Oryctolagus cuniculus (rabbit): 100351218
Entry
100351218         CDS       T03373                                 
Symbol
CLDN5
Name
(RefSeq) claudin 5
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100351218 (CLDN5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100351218 (CLDN5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100351218 (CLDN5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100351218 (CLDN5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100351218 (CLDN5)
   04147 Exosome [BR:ocu04147]
    100351218 (CLDN5)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100351218 (CLDN5)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100351218 (CLDN5)
  Exosomal proteins of colorectal cancer cells
   100351218 (CLDN5)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 100351218
NCBI-ProteinID: XP_002723615
Ensembl: ENSOCUG00000006403
LinkDB
Position
Un
AA seq 218 aa
MGSAALEILGLVLCLVGWVGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTG
HMQCKVYESVLALSAEVQAARALTVGAVLLALVALFVTLAGAQCTTCVAPGPGKARVALT
GGALYALCGLLALVPLCWFANIVVREFYDPAVPVSQKYELGAALYIGWAASALLMCGGGL
VCCGAWVCAGRPNLSFPVKYSAPRRPTASGDYDKKNYV
NT seq 657 nt   +upstreamnt  +downstreamnt
atggggtccgccgcgctggagatcctgggcctggtgctgtgcctggtgggctgggtgggg
ctgattttggcgtgcgggctgcccatgtggcaggtgactgctttcctggaccacaacatc
gtgacggcgcagaccacctggaaggggctgtggatgtcgtgcgtggtgcagagcaccggg
cacatgcagtgcaaggtgtatgagtcggtgctggcgctgagcgccgaggtgcaggcggcg
cgagcgctcaccgtgggcgccgtgctgctggcgctcgtcgccctcttcgtgaccctggcg
ggcgctcagtgcaccacctgcgtggcccccggcccgggcaaggcgcgcgtggccctcacg
ggcggcgcactctatgcgctctgcgggctcctggcgctcgtgccgctctgctggttcgcc
aacatcgtggtccgcgagttctacgaccccgcagtgcccgtgtcgcagaagtacgagctg
ggcgccgcgctgtacataggctgggcggcctcggcgctgctcatgtgcggcggcggtctc
gtgtgctgcggcgcctgggtctgcgcgggccgccccaacctcagcttcccggttaagtac
tcggcaccgcggcggccaacggccagcggcgactacgataagaaaaactacgtttga

KEGG   Oryctolagus cuniculus (rabbit): 100352273
Entry
100352273         CDS       T03373                                 
Symbol
CLDN11
Name
(RefSeq) claudin 11
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100352273 (CLDN11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100352273 (CLDN11)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100352273 (CLDN11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100352273 (CLDN11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100352273 (CLDN11)
   04147 Exosome [BR:ocu04147]
    100352273 (CLDN11)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100352273 (CLDN11)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100352273 (CLDN11)
  Exosomal proteins of colorectal cancer cells
   100352273 (CLDN11)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100352273
NCBI-ProteinID: XP_002716460
Ensembl: ENSOCUG00000005520
UniProt: G1SP37
LinkDB
Position
14:65333826..65348476
AA seq 207 aa
MVATCLQVVGFVTSFVGWIGIIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT
GLYHCKPLVDILILPGYVQACRALMIAASVLGLPAIFLLLTVLPCIRMGHEPGVAKYRRA
QLAGVLLILVALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVMCLVGGCVIVCCAG
DAQAFGENRFYYSSGSSSPTHAKSAHV
NT seq 624 nt   +upstreamnt  +downstreamnt
atggtggccacgtgcctgcaggtggtgggcttcgtcacgagcttcgtgggctggatcggc
atcatcgtcaccacatccaccaacgactgggtggtgacctgcggctacaccatccccacc
tgccgcaagctggacgaactgggctccaaggggctgtgggccgactgcgttatggccacg
gggttgtaccactgcaagcccctggtggacatcctcatcctgccgggctacgttcaagct
tgccgagccctgatgattgctgcctccgtcctgggtctgccggccatcttcctgctgctc
actgttctcccctgcatccgaatgggccatgagcctggcgtggccaagtacaggcgggca
cagctggctggcgttctgctcatcctagtggccctctgcgccatcgtcgccaccatctgg
ttccccgtgtgcgctcaccgagagaccaccatcgtgagcttcggctactccctgtatgcg
ggctggatcggtgctgtgatgtgcctcgtgggcggctgcgtcatcgtctgctgcgccgga
gacgcccaggcgtttggtgaaaaccgattctactactcctccggctccagctccccgacg
catgccaagagcgcccacgtgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100353209
Entry
100353209         CDS       T03373                                 
Symbol
CLDN2
Name
(RefSeq) claudin 2
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100353209 (CLDN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100353209 (CLDN2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100353209 (CLDN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100353209 (CLDN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100353209 (CLDN2)
   04147 Exosome [BR:ocu04147]
    100353209 (CLDN2)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100353209 (CLDN2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100353209 (CLDN2)
  Exosomal proteins of colorectal cancer cells
   100353209 (CLDN2)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064 Amastin
Other DBs
NCBI-GeneID: 100353209
NCBI-ProteinID: XP_008271068
Ensembl: ENSOCUG00000012629
LinkDB
Position
X:55530283..55539669
AA seq 229 aa
MASLGLQLVGYILGLLGLLGTMIAMLLPNWRTSSYVGASIVTAVGFSKGLWMECATQSTG
ITQCDIYNTLLGLPADIQAAQAMMVTSSAFSSLACIISVVGMRCTIFCKESRAKDRVAIA
GGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLVAGII
LCFSCPSQGNRSNYDAYQAQPLATRSSPRPGQPPKVKNEFNSYSLTGYV
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcctctcttggcctccaacttgtgggctacatcctaggcctcctgggactgttgggc
accatgattgccatgcttctccccaactggcgaacgagctcttacgtcggcgccagcatc
gtgacagcagttggtttctccaaaggcctctggatggagtgtgccacacagagcacaggc
atcacccagtgtgacatctacaacaccctcctaggcctacccgctgatatccaggctgct
caggccatgatggtgacatccagtgccttctcctcactggcctgcattatctctgtggtg
ggcatgagatgcacgatcttctgcaaggaatcccgagccaaagacagagtggcgatagca
ggtggagtcttcttcatccttggaggtctcctgggcttcatcccggttgcctggaatcta
catgggatccttcgggacttctactcaccactggtgcctgacagcatgaaatttgagatc
ggagaggctctttacttgggcattatttcctctctgttctccctggtagctggcatcatc
ctctgcttctcttgcccatcccagggaaatcgctccaactatgatgcctaccaggcccag
ccccttgccactaggagctctccaaggcctggccaacctcccaaagtgaagaatgagttc
aactcctacagcctaacagggtatgtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100354623
Entry
100354623         CDS       T03373                                 
Symbol
CLDN17
Name
(RefSeq) claudin 17
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100354623 (CLDN17)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100354623 (CLDN17)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100354623 (CLDN17)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100354623 (CLDN17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100354623 (CLDN17)
   04147 Exosome [BR:ocu04147]
    100354623 (CLDN17)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100354623 (CLDN17)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100354623 (CLDN17)
  Exosomal proteins of colorectal cancer cells
   100354623 (CLDN17)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 DUF4064 Claudin_3 Clc-like MFS_MOT1
Other DBs
NCBI-GeneID: 100354623
NCBI-ProteinID: XP_002716832
Ensembl: ENSOCUG00000025369
LinkDB
Position
14:complement(159697657..159698892)
AA seq 224 aa
MAFYPLQIAGLVCGFLGMVGTLATTLLPQWRVSAFIGSNIIVFERIWEGLWMNCVRQARV
RFQCKFYSSLLALPPVLEAARALMCVALALSLIALLIGICGMKQIQCTGANEKVKVYLLG
TSGVLFILTGIFILIPVCWTANIIIRDFYNPTINAGQKRELGAALFIGWASSAVLFIGGG
LLCGFFWCNRKVQRQRYPAPVDCAPRTEKQRNVTVISKSCTSYV
NT seq 675 nt   +upstreamnt  +downstreamnt
atggcgttttatccactgcaaattgccgggctggtgtgtgggttcctcggcatggttggg
actcttgccacaacacttctgcctcagtggagagtatcagcgttcattggcagcaacatt
attgtctttgaaaggatctgggaagggctctggatgaattgcgtccgacaagccagggtt
aggtttcagtgcaaattctatagttccttgctggctctcccacctgtcctggaagcagca
cgggctctcatgtgtgtggctcttgctctctccttgattgccctgcttattggcatttgt
ggcatgaagcagatccagtgcacaggcgctaatgagaaggtgaaagtgtaccttctgggc
acctctggagttctcttcatcctgaccggcatcttcattctgattccagtgtgctggaca
gccaatatcatcatcagggatttctataacccaaccatcaacgcaggccagaaacgagaa
ctgggagcagcacttttcatcggctgggcaagctctgcggtcctcttcattggaggaggt
ttgctctgtggattcttctggtgcaacagaaaggtgcaaaggcaaagatatccagctcct
gtggactgcgcgcctcgcacagagaagcaaaggaatgtgacggtgatcagtaagagctgc
accagttatgtctaa

KEGG   Oryctolagus cuniculus (rabbit): 100354880
Entry
100354880         CDS       T03373                                 
Symbol
CLDN8
Name
(RefSeq) claudin 8
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100354880 (CLDN8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100354880 (CLDN8)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100354880 (CLDN8)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100354880 (CLDN8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100354880 (CLDN8)
   04147 Exosome [BR:ocu04147]
    100354880 (CLDN8)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100354880 (CLDN8)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100354880 (CLDN8)
  Exosomal proteins of colorectal cancer cells
   100354880 (CLDN8)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 100354880
NCBI-ProteinID: XP_008265399
Ensembl: ENSOCUG00000008920
LinkDB
Position
14:complement(159760616..159763236)
AA seq 225 aa
MATYILQIAGLMFGGVGMVGTLAVTIMPQWRVSAFIESNIVIFENLWEGLWMNCMRHANI
RMQCKVYDSLLALSPDLQASRGLMCAASVLSFLAFMTAIVGMKCTRCTGDDEKVKGHILL
TAGIIFIVTGILVLIPVSWVANSIIRDFYNPIVNVAQKRELGEALYIGWTTSLLLIAAGT
LFCCGFCCTEKSSSYRYSIPSHRTTQKSYHMEKKSPSVYSKSQYV
NT seq 678 nt   +upstreamnt  +downstreamnt
atggcgacctatattctgcaaattgctggactgatgtttggcggtgttggcatggtgggc
acgttggctgtcaccatcatgcctcagtggagagtgtctgccttcatcgaaagcaacatc
gtgatatttgaaaacctctgggagggcctgtggatgaattgcatgaggcacgctaacatc
aggatgcagtgcaaagtctatgattccctgctggctctttctccagacctgcaggcatcc
agaggactcatgtgtgctgcttctgtgctgtccttcttggctttcatgacagccatcgtc
ggcatgaagtgcactaggtgcactggggacgatgaaaaggtgaaaggtcacatcctactc
acagctggaatcatcttcatcgtcacaggcatcttggtgctcatccctgtgagctgggtt
gctaattccatcattagggatttctacaacccaatagtgaatgttgcccagaaacgcgag
cttggagaagccctctacataggctggaccacctcgctgctgttgattgctgcagggacc
ctgttctgctgtggtttctgctgtactgagaagagcagtagctacagatactcaatacct
tcccatcgcacaacccaaaagagttatcacatggaaaagaagtcaccgagtgtgtactcc
aaaagtcagtatgtgtag

KEGG   Oryctolagus cuniculus (rabbit): 100355124
Entry
100355124         CDS       T03373                                 
Symbol
CLDN10
Name
(RefSeq) claudin 10
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100355124 (CLDN10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100355124 (CLDN10)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100355124 (CLDN10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100355124 (CLDN10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100355124 (CLDN10)
   04147 Exosome [BR:ocu04147]
    100355124 (CLDN10)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100355124 (CLDN10)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100355124 (CLDN10)
  Exosomal proteins of colorectal cancer cells
   100355124 (CLDN10)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 YccF
Other DBs
NCBI-GeneID: 100355124
NCBI-ProteinID: XP_008258323
Ensembl: ENSOCUG00000009438
UniProt: G1SX77
LinkDB
Position
8:97335756..97464749
AA seq 231 aa
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKTCVTDSTGV
SNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLA
GIVFILSGLCSMTGCSLYANKITTEFFDPLYVEQKYELGAALFIGWAGASLCIIGGIIFC
FSISDNSKTPRMAYTYNGATSVMSSRTKYHGGEGDFKSTNPSKQFDKNAYV
NT seq 696 nt   +upstreamnt  +downstreamnt
atggcgagcacggcctcggagatcatcgccttcatggtctccatctcaggctgggtgctg
gtgtcctccacgctgcccaccgactattggaaggtgtccaccatcgacggcacggtcatc
accacggccacctattgggccaacctgtggaagacgtgcgtcaccgactccaccggcgtc
tccaactgcaaggatttcccctccatgctggcgctggacggttatatccaggcatgtaga
ggactgatgatcgcggctgtcagcctgggcttttttggttccatttttgcactctttgga
atgaagtgtaccaaagtgggaggctcagataaagccaaagctaaaattgcctgtttggct
gggattgtattcatcctgtcaggactgtgctcaatgactggctgttccctgtatgcaaac
aagatcaccacagaattctttgatcctctctatgttgagcaaaagtatgaactgggagcc
gctctgttcatcggatgggcaggagcctcactctgcataattggtggtatcatattttgc
ttttcaatatctgacaacagcaaaacacccagaatggcatacacgtacaatggagccacg
tctgtcatgtcgtctcggacaaagtatcatggtggagaaggagatttcaaatctacaaac
ccttcaaaacagtttgataaaaacgcctatgtctga

KEGG   Oryctolagus cuniculus (rabbit): 100356384
Entry
100356384         CDS       T03373                                 
Symbol
CLDN16
Name
(RefSeq) claudin 16
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100356384 (CLDN16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100356384 (CLDN16)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100356384 (CLDN16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100356384 (CLDN16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100356384 (CLDN16)
   04147 Exosome [BR:ocu04147]
    100356384 (CLDN16)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100356384 (CLDN16)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100356384 (CLDN16)
  Exosomal proteins of colorectal cancer cells
   100356384 (CLDN16)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like DuoxA
Other DBs
NCBI-GeneID: 100356384
NCBI-ProteinID: XP_008264873
Ensembl: ENSOCUG00000011471
LinkDB
Position
14:86069855..86097046
AA seq 254 aa
MDPGLAAVHMSLQNRLLTTMRDHLQYLACFLAFFSTGFLIAATWTDCWMVNADDSLEVST
KCRGLWWECVTNAFDGIRTCDEYDSIYAEHPLKLVATRALMITADILAGFGFISLILGLD
CIKFLPNEPYIKARICFVAGTTMLIAGVPGIIGSLWYAVDVYVERSSLILHNVFLGIQYK
FGWSCWLAMAGSLGCFLAGGSLTCCLYLFKDVGPERNYPYSMRKLYSTTGVSMAKSYVAP
RTETAKMYAIDTRV
NT seq 765 nt   +upstreamnt  +downstreamnt
atggatccagggctggctgccgtccatatgtctcttcagaacagattgctaaccaccatg
agggatcatcttcaataccttgcctgcttcttggcctttttctccactgggtttttgatt
gcggccacctggacagactgttggatggtgaatgctgatgattccttggaggtgagcaca
aaatgccgaggcctctggtgggagtgtgtcacaaatgcttttgatgggattcgcacctgt
gatgagtatgattccatatatgcagaacaccccttgaagctggtggcaacccgagcattg
atgattactgcagatattctagctggatttggattcatcagcctgatccttggtcttgac
tgcataaaattccttcctaatgagccatacattaaagcgcgcatctgctttgttgctgga
accaccatgctaatagcaggtgtcccaggaatcattggctctctgtggtatgctgttgat
gtttacgtagaacgttcttctctgattttacataatgtatttcttggcatccaatataaa
tttggttggtcctgttggcttgcaatggctgggtctctgggttgctttttagctggaggt
tctctcacctgctgcttatacctctttaaagatgttggacctgagagaaactatccttat
tccatgaggaagctctattcaactactggtgtttccatggccaagtcatatgtggcccct
cggacagagactgccaaaatgtatgctatagacactagagtatga

KEGG   Oryctolagus cuniculus (rabbit): 100356567
Entry
100356567         CDS       T03373                                 
Symbol
CLDN20
Name
(RefSeq) claudin 20
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100356567 (CLDN20)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100356567 (CLDN20)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100356567 (CLDN20)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100356567 (CLDN20)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100356567 (CLDN20)
   04147 Exosome [BR:ocu04147]
    100356567 (CLDN20)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100356567 (CLDN20)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100356567 (CLDN20)
  Exosomal proteins of colorectal cancer cells
   100356567 (CLDN20)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100356567
NCBI-ProteinID: XP_017200932
Ensembl: ENSOCUG00000012158
UniProt: G1T2Q2
LinkDB
Position
12:145506605..145507760
AA seq 219 aa
MASEGLQLLAFTLALSGVSGVLTATLLPNWKVKVDVGSNILMAMVRLHGLWMDCTWYSTG
MFSCTLKYSILSLPTLVQAARVAMVLACILSALGICTSTVGMKCTRLGGDRETKSQASFA
GGVCFMSAGVSGFIPAVWYTKEIIASFLDPTIPESNKYEPGGALYIGFISAMLLFISGII
FCTSCIKRKPEAWLHTHTQQHVSAPQPESRPAYNLKDYV
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcctcggaggggctccagctcctggccttcaccctggccctgtctggggtttccgga
gtgctcacggccactctgctgcccaactggaaggtgaaggtggatgtgggctccaacatc
ctcatggccatggtccggctccatgggctgtggatggactgcacgtggtacagcaccggc
atgttcagctgcaccctgaaatactccattctgtccctccccacgctcgtgcaggctgcg
agggtcgccatggtgctggcatgcatcctgtctgccttgggaatctgcacatccaccgtg
ggaatgaagtgcacccgcttaggaggtgacagagagaccaagagtcaggcttcctttgcc
ggaggagtctgtttcatgtctgcgggggtctctggtttcataccagcagtgtggtacacc
aaggagatcatagcaagcttcctggatcccacaattccagagagcaacaaatacgaacca
ggaggagcactctacattggattcatttcggcaatgctgctgtttatctctggcattatt
ttctgcacttcctgtataaaaaggaagccagaggcctggctccacacacacacgcagcag
cacgtctcagccccgcagccagagagcagacctgcctacaacctgaaggattatgtatag

KEGG   Oryctolagus cuniculus (rabbit): 100357396
Entry
100357396         CDS       T03373                                 
Symbol
CLDN19
Name
(RefSeq) claudin 19
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100357396 (CLDN19)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100357396 (CLDN19)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100357396 (CLDN19)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100357396 (CLDN19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100357396 (CLDN19)
   04147 Exosome [BR:ocu04147]
    100357396 (CLDN19)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100357396 (CLDN19)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100357396 (CLDN19)
  Exosomal proteins of colorectal cancer cells
   100357396 (CLDN19)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Amastin SUR7 Mntp
Other DBs
NCBI-GeneID: 100357396
NCBI-ProteinID: XP_002715224
Ensembl: ENSOCUG00000026826
UniProt: G1U697
LinkDB
Position
13:123991458..123998603
AA seq 313 aa
MSSAGTLPWLSQQLWAGPWPFPTPEPPPAFWSPELLPLLSLPLLPPPLPLIAHCSPAQLP
FSPGHAHSAPGDSSPALSPGTLSPLSPRAMANSGLQLLGYFLALGGWVGIIASTALPQWK
QSSYAGDAIITAVGLYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSARALMVVAVLLG
FVAMVLSVVGMKCTRVGDSNPIAKGRVAIAGGALFLLAGLCTLTAVSWYATLVTREFFNP
STPVNARYEFGPALFVGWASAGLAMLGGSFLCCTCPEPERANSSPQPYRPGPSAAAREPV
VKLPASAKGPLGV
NT seq 942 nt   +upstreamnt  +downstreamnt
atgagctctgctgggaccctgccctggcttagccagcagctgtgggcgggcccctggcct
tttccaaccccagagcctccccctgcattctggagtccggagctgttgcctctgctgtcg
ctgccgctgctgccaccgccactgcccttgatcgctcactgctcccccgcccagctgccc
ttctcacctggccatgcgcacagtgcccctggggactccagcccagctctgagccctggg
accctcagccccctctcccccagggccatggccaactcgggcctccagctcctggggtac
ttcctggccctgggcggctgggtgggcatcatcgccagcacggcactgccgcaatggaag
cagtcctcctacgcgggcgacgccatcatcactgccgtgggcctctacgaagggctgtgg
atgtcctgcgcctcccagagcaccggccaggtgcagtgcaagctctacgactcgctgctt
gccctggacggtcacatccagtctgcgcgagccctgatggtggtggctgtgctcctgggc
ttcgtggccatggtcctcagtgtggtcggcatgaagtgcacgcgcgtcggggacagcaac
cccatcgctaagggccgtgtggccatcgccgggggcgccctattcctcctggcaggcctc
tgcaccctgacggccgtctcgtggtatgccaccctggtgacccgggagttcttcaacccc
agcacgcctgtcaacgccaggtatgaatttggccccgccctgttcgtgggctgggcctcg
gctggcctggccatgctgggaggctccttcctctgctgcacgtgccctgagcccgagaga
gccaacagcagcccgcagccctaccggcccggcccttcggctgctgcccgagaaccagtc
gttaaattgcccgcctccgccaagggccccctgggtgtgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100357702
Entry
100357702         CDS       T03373                                 
Symbol
CLDN15
Name
(RefSeq) claudin 15
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100357702 (CLDN15)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100357702 (CLDN15)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100357702 (CLDN15)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100357702 (CLDN15)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    100357702 (CLDN15)
   04147 Exosome [BR:ocu04147]
    100357702 (CLDN15)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   100357702 (CLDN15)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   100357702 (CLDN15)
  Exosomal proteins of colorectal cancer cells
   100357702 (CLDN15)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2
Other DBs
NCBI-GeneID: 100357702
NCBI-ProteinID: XP_002722865
Ensembl: ENSOCUG00000010209
UniProt: G1SYU1
LinkDB
Position
Un
AA seq 227 aa
MSVAVETFGFFMAALGLLMLGVTLPNSYWRVSTVHGNVITTNTIYENLWYSCATDSLGVS
NCWEFPSMLALSGYVQACRALMITAILLGFLGLFLGMVGLRCTKVGGTEPSRKAKLAATA
GALHMLAGLCGMVAISWYAANITQDFFNPLYAGTKYELGPALYLGWSASLLSILGGICLC
SNCCCQPREDPTTRAQLPYKASTAVMPPAASDEGDSSFGKYGKNAYV
NT seq 684 nt   +upstreamnt  +downstreamnt
atgtcggtggcggtggagacatttggcttcttcatggcggccctggggctgctgatgctc
ggggtgaccctgcccaacagctactggcgagtgtccacggtgcacggcaacgtcatcacc
accaacaccatctacgagaacctctggtacagctgcgccaccgactccctgggagtctcc
aactgctgggagttcccgtccatgctggccctgtctggatacgtccaggcctgccgcgcc
ctcatgatcaccgccatcctcctgggcttcctgggcctcttcctgggcatggtggggctg
cgctgcaccaaagtcggaggcaccgagccctccaggaaagccaagctggcagccacggcg
ggcgccctgcacatgctggctgggctctgcggcatggtggccatttcctggtacgcggcc
aacatcacccaggatttcttcaaccccttgtatgccgggaccaagtacgagctgggcccc
gccctctacctgggctggagcgcctccctgctgtccatcctgggcggcatctgcctctgc
tccaactgctgctgccagcctagagaggaccccaccaccagggcccagcttccctacaag
gcgtccaccgccgtgatgccccccgctgcctcggatgaaggcgatagcagctttggcaaa
tatggcaagaatgcttacgtgtag

KEGG   Oryctolagus cuniculus (rabbit): 108175401
Entry
108175401         CDS       T03373                                 
Name
(RefSeq) putative claudin-24
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108175401
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108175401
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    108175401
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    108175401
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    108175401
   04147 Exosome [BR:ocu04147]
    108175401
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   108175401
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   108175401
  Exosomal proteins of colorectal cancer cells
   108175401
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 Clc-like
Other DBs
NCBI-GeneID: 108175401
NCBI-ProteinID: XP_017193841
UniProt: G1TZX6
LinkDB
Position
2:complement(60664835..60666072)
AA seq 220 aa
MAFDFKTAMQSLGLLLSFLGWVLSIMTTYLPLWKNLNLDLNEMEHWTLGLWQTCVVQEEV
GTQCKGFDSFLALPAELRIARIFMFLCNGLGFLGLLVSGSGLDCLRIGESQQELKKRLLV
LGGILSWTSGITALVPVSWVAHVTVQEFWDETLPEIVPRWEFGEALFLGWGAGFSLLVGG
CLLHCAACSARAPLAAGHYAVADMQTQCPHLEDGTADPKV
NT seq 663 nt   +upstreamnt  +downstreamnt
atggcttttgacttcaaaacagcaatgcaatctcttggacttttattatctttcctggga
tgggttttgtccattatgacaacttacttgccactctggaagaacctcaacctggactta
aatgagatggaacactggaccctgggactctggcagacttgtgtcgtccaggaggaagtg
ggcacgcagtgcaagggcttcgactctttcctggctttgcctgctgaactccggatcgcc
aggattttcatgtttctgtgcaacgggctggggttcctgggcctgctggtctcggggtct
ggcctggactgcttgagaatcggagagagccagcaagagctcaagaagcgcctgctcgtc
ctggggggaatcctgtcctggacgtcaggcatcacagccctggtgccggtctcgtgggtg
gcccacgtgacggtccaggagttctgggacgagacccttccggagattgtgccccggtgg
gagtttggggaggccctgttcctgggctggggtgctggcttctccctcctcgtgggaggg
tgtctgcttcactgtgcagcctgctccgcccgggctccgctcgctgccggccactacgcg
gtggcagatatgcagactcagtgtccacatctggaagacggaactgcagatcccaaagtg
taa

KEGG   Oryctolagus cuniculus (rabbit): 108175450
Entry
108175450         CDS       T03373                                 
Symbol
CLDN34
Name
(RefSeq) claudin 34
  KO
K06087  claudin
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04514  Cell adhesion molecules
ocu04530  Tight junction
ocu04670  Leukocyte transendothelial migration
ocu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    108175450 (CLDN34)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    108175450 (CLDN34)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    108175450 (CLDN34)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    108175450 (CLDN34)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:ocu03037]
    108175450 (CLDN34)
   04147 Exosome [BR:ocu04147]
    108175450 (CLDN34)
Cilium and associated proteins [BR:ocu03037]
 Other cilia and associated proteins
  Stereociliary proteins
   108175450 (CLDN34)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   108175450 (CLDN34)
  Exosomal proteins of colorectal cancer cells
   108175450 (CLDN34)
SSDB
Motif
Pfam: Claudin_2 PMP22_Claudin YiaAB
Other DBs
NCBI-GeneID: 108175450
NCBI-ProteinID: XP_002721723
UniProt: A0A5F9CI61
LinkDB
Position
Un
AA seq 223 aa
MTLLVNSANRQVAGFAISTIGWILFTTSMGLAEWRLWYMDDPLLSPKGFASVGIWRTCVY
HHHRDSNQSHGHTKFCHRHTYNDTFLPLSIRVSQHLLLAANLLGLLGKAFIIFALRNVYM
GIGGTNTLFNPFVASGVLYIITSVCVLTTAFWNYYSIVNVQGIAFPSSFHLPFKPDTQEA
GSAILVAALSALLMFLSGLVFCLYKFPPDRNVYPEVSKTRIFW
NT seq 672 nt   +upstreamnt  +downstreamnt
atgaccttacttgtcaatagtgccaatcgccaagtagcaggttttgccatttccaccata
ggatggatcctcttcaccacttccatgggccttgcagaatggcgattgtggtacatggat
gaccccttgctctcccccaaaggatttgccagtgtgggaatatggagaacctgcgtttat
caccatcaccgcgactccaaccaaagccacggacataccaaattctgtcaccgacacacc
tacaatgataccttcctccctctcagtatccgtgtttctcaacatctcctgctggctgcc
aaccttctagggcttctggggaaggcctttatcatctttgcacttagaaatgtgtacatg
ggcattggggggacgaataccctcttcaacccatttgtggcttctggagtcctgtacata
attactagtgtctgtgtcttaaccactgcattctggaattactactccattgtgaatgta
caaggcattgccttcccatcatctttccatctgccattcaagccggatactcaggaagct
gggagtgccattctagtggcagctctctctgccctcctcatgtttttgagtggcttggtt
ttctgcctttacaagtttcccccggacagaaacgtgtaccctgaggtttcaaaaacacga
attttctggtaa

DBGET integrated database retrieval system