KEGG   Oryctolagus cuniculus (rabbit): 100101556
Entry
100101556         CDS       T03373                                 
Symbol
CAMK2G
Name
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04114  Oocyte meiosis
ocu04217  Necroptosis
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04740  Olfactory transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04934  Cushing syndrome
ocu04971  Gastric acid secretion
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05214  Glioma
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100101556 (CAMK2G)
   04310 Wnt signaling pathway
    100101556 (CAMK2G)
   04066 HIF-1 signaling pathway
    100101556 (CAMK2G)
   04020 Calcium signaling pathway
    100101556 (CAMK2G)
   04024 cAMP signaling pathway
    100101556 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100101556 (CAMK2G)
   04217 Necroptosis
    100101556 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100101556 (CAMK2G)
   04922 Glucagon signaling pathway
    100101556 (CAMK2G)
   04912 GnRH signaling pathway
    100101556 (CAMK2G)
   04921 Oxytocin signaling pathway
    100101556 (CAMK2G)
   04916 Melanogenesis
    100101556 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    100101556 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100101556 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    100101556 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    100101556 (CAMK2G)
   04728 Dopaminergic synapse
    100101556 (CAMK2G)
   04720 Long-term potentiation
    100101556 (CAMK2G)
   04722 Neurotrophin signaling pathway
    100101556 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    100101556 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    100101556 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    100101556 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100101556 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100101556 (CAMK2G)
   05205 Proteoglycans in cancer
    100101556 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    100101556 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100101556 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100101556 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    100101556 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    100101556 (CAMK2G)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100101556 (CAMK2G)
   05415 Diabetic cardiomyopathy
    100101556 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100101556 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100101556 (CAMK2G)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100101556 (CAMK2G)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100101556 (CAMK2G)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Kdo Pkinase_fungal SnoaL_2 ABC1 RIO1
Other DBs
NCBI-GeneID: 100101556
NCBI-ProteinID: NP_001093423
Ensembl: ENSOCUG00000012578
UniProt: O77707
LinkDB
Position
18:13642341..13697703
AA seq 518 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRATVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSAAKSLLNKKSDGGVKPQSNNKISLVSPAQEPAPLQTAMEPQTTVV
HNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSF
EPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDG
QGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1557 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagctcttcgaggagctc
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaagagtat
gcagcaaaaatcatcaataccaagaagttgtctgcccgagatcaccagaagctagaacgt
gaggcccggatatgccgacttctgaaacacccaaacatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgttcgacctcgtcactggaggggagctgtttgaa
gacattgtggccagagagtactacagcgaggcagacgccagccactgtatacaccagatt
ctggagagtgttaaccacattcaccagcatgacattgtacacagggacctgaagcctgag
aacttgctgctggcgagtaaatgcaagggtgccgccgtcaagctggctgactttggcctc
gccatcgaagtacagggagagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccgtatggaaaacctgtggatatctgggcttgc
ggggtcatcctgtatatcctcctggtgggataccctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaggctggagcctatgatttcccatcgccagaatgggatacg
gtgactcctgaagccaagaacttgatcaaccagatgttgaccataaacccggcaaagcgc
atcacggctgaccaggctctcaagcacccatgggtctgccaacgagccacggtggcttcc
atgatgcatcgccaggagaccgtggagtgcttgcgcaagttcaatgcccggaggaaactg
aagggtgccatcctcacgaccatgctggtctccaggaacttctcagctgccaaaagccta
ttgaacaagaagtcggatggtggtgtcaagccacagagcaacaacaaaatcagtctcgta
agcccagcccaagagcccgcgcccttgcagacggccatggagccacaaactaccgtggtg
cacaacgctacagatgggatcaagggctccacagagagctgcaacaccactacagaagat
gaggacctcaaagtgcgaaaacaggagatcattaagatcacagaacagctgattgaagcc
atcaacaatggggactttgaggcctacacgaagatttgtgatccgggcctcacttccttt
gagccggaggcccttggtaacctcgtggaggggatggatttccataagttttactttgag
aatctcctgtccaagaacagcaagcccatccataccaccatcctaaacccacatgtccac
gtgatcggagaggacgcagcttgcatcgcctacatccgcctcacccagtacatcgacggg
cagggtcggccccgcaccagccagtcggaggagacccgggtctggcaccgccgggatggc
aagtggctcaatgtccactaccactgctcaggggcccctgccgcaccgctgcagtga

KEGG   Oryctolagus cuniculus (rabbit): 100101557
Entry
100101557         CDS       T03373                                 
Symbol
CAMK2D
Name
(RefSeq) calcium/calmodulin dependent protein kinase II delta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04114  Oocyte meiosis
ocu04217  Necroptosis
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04740  Olfactory transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04934  Cushing syndrome
ocu04971  Gastric acid secretion
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05214  Glioma
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100101557 (CAMK2D)
   04310 Wnt signaling pathway
    100101557 (CAMK2D)
   04066 HIF-1 signaling pathway
    100101557 (CAMK2D)
   04020 Calcium signaling pathway
    100101557 (CAMK2D)
   04024 cAMP signaling pathway
    100101557 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100101557 (CAMK2D)
   04217 Necroptosis
    100101557 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100101557 (CAMK2D)
   04922 Glucagon signaling pathway
    100101557 (CAMK2D)
   04912 GnRH signaling pathway
    100101557 (CAMK2D)
   04921 Oxytocin signaling pathway
    100101557 (CAMK2D)
   04916 Melanogenesis
    100101557 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    100101557 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100101557 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    100101557 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    100101557 (CAMK2D)
   04728 Dopaminergic synapse
    100101557 (CAMK2D)
   04720 Long-term potentiation
    100101557 (CAMK2D)
   04722 Neurotrophin signaling pathway
    100101557 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    100101557 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    100101557 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    100101557 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100101557 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100101557 (CAMK2D)
   05205 Proteoglycans in cancer
    100101557 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    100101557 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100101557 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100101557 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    100101557 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    100101557 (CAMK2D)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100101557 (CAMK2D)
   05415 Diabetic cardiomyopathy
    100101557 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100101557 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100101557 (CAMK2D)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100101557 (CAMK2D)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100101557 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 100101557
NCBI-ProteinID: NP_001093424
Ensembl: ENSOCUG00000023650
UniProt: O77708
LinkDB
Position
15:35624200..35938748
AA seq 499 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWISHRATVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGEDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPP
CIPNGKENYSGGTSLWQNI
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcttcaaccaccacctgcaccaggttcacggacgagtatcagcttttcgaggagctc
ggaaagggggcattctcagtggtgagaagatgtatgaaaatccctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactggaaagg
gaagctagaatttgccgtcttttgaagcaccccaatattgtgagacttcatgacagcata
tcagaagagggctttcactacttggtgtttgatttagttactggaggcgaactctttgaa
gacatagtggcaagagaatattacagtgaagcagacgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaactggcagactttggctta
gccatagaagtacaaggagaccagcaggcatggtttggttttgctgggacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctacattctactggtaggatatccacccttctgggatgaagaccagcac
agactctatcagcaaatcaaggctggagcttatgattttccatcaccagaatgggacaca
gtaacccctgaagccaaagatctcatcaataaaatgcttactatcaaccctgccaaacgc
attacagcctcggaggcactgaaacatccatggatcagtcaccgtgctactgtggcttcc
atgatgcacagacaggagactgtagactgcttgaagaaattcaatgctagaagaaaacta
aagggtgccatcttgacaaccatgctggctacaaggaatttttcagcagccaagagtttg
ttgaagaaaccagatggagtaaaggaatcaactgagagttcaaatacaacaattgaagat
gaagatgtaaaagcacgaaagcaagagattatcaaggtcactgaacagctgattgaagct
atcaacaatggggattttgaggcttacacaaaaatctgtgacccaggtcttactgcattt
gaacctgaagctttgggtaatttagtggaagggatggactttcaccgattctactttgaa
aatgctttgtcaaaaagcaataaaccaatccacactattatcctgaaccctcatgtccat
ctggtaggggaggatgctgcctgcatagcatacattaggctcacacagtacatggatggc
agtggcatgccaaagacaatgcagtcagaagagacccgtgtatggcatcgccgggatggc
aagtggcagaatgttcattttcatcgctcaggctcgccaacagtacccatcaagccacct
tgtattccaaatgggaaagaaaactactcaggaggcacctctttgtggcaaaacatctaa

KEGG   Oryctolagus cuniculus (rabbit): 100341507
Entry
100341507         CDS       T03373                                 
Symbol
CAMK2A
Name
(RefSeq) calcium/calmodulin dependent protein kinase II alpha
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04114  Oocyte meiosis
ocu04217  Necroptosis
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04740  Olfactory transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04934  Cushing syndrome
ocu04971  Gastric acid secretion
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05214  Glioma
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100341507 (CAMK2A)
   04310 Wnt signaling pathway
    100341507 (CAMK2A)
   04066 HIF-1 signaling pathway
    100341507 (CAMK2A)
   04020 Calcium signaling pathway
    100341507 (CAMK2A)
   04024 cAMP signaling pathway
    100341507 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100341507 (CAMK2A)
   04217 Necroptosis
    100341507 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100341507 (CAMK2A)
   04922 Glucagon signaling pathway
    100341507 (CAMK2A)
   04912 GnRH signaling pathway
    100341507 (CAMK2A)
   04921 Oxytocin signaling pathway
    100341507 (CAMK2A)
   04916 Melanogenesis
    100341507 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    100341507 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100341507 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    100341507 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    100341507 (CAMK2A)
   04728 Dopaminergic synapse
    100341507 (CAMK2A)
   04720 Long-term potentiation
    100341507 (CAMK2A)
   04722 Neurotrophin signaling pathway
    100341507 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    100341507 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    100341507 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    100341507 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100341507 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100341507 (CAMK2A)
   05205 Proteoglycans in cancer
    100341507 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    100341507 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100341507 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100341507 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    100341507 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    100341507 (CAMK2A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100341507 (CAMK2A)
   05415 Diabetic cardiomyopathy
    100341507 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100341507 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100341507 (CAMK2A)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100341507 (CAMK2A)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100341507 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 APH Pkinase_fungal Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 100341507
NCBI-ProteinID: XP_008253477
Ensembl: ENSOCUG00000017865
LinkDB
Position
3:complement(31982340..32046307)
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSAGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSALPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggcaaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaactggga
aagggagccttctccgtcgtgcgccgctgtgtgaaggtgctggccggccaggagtatgcc
gccaagatcatcaacaccaagaaactctcagccagagaccatcagaagttggagcgcgag
gcccgcatctgccgcctgctcaagcaccccaacatcgtccgcctgcacgacagcatctct
gaggagggacaccactacctgatcttcgacctggtcactggcggggagctgtttgaagac
atcgtggcccgggagtattacagtgaggcagatgccagtcactgtatccagcagatcctg
gaggccgtgctgcactgccaccagatgggggtggtgcaccgggacctgaagccggagaat
ctgctgctggcctccaagctcaagggtgctgctgtgaagctggcggactttggcctggcc
atagaggtggagggggagcagcaggcgtggtttgggtttgcagggacccccggatacctg
tccccagaagtgctgcgcaaggacccgtatgggaagcctgtggacctgtgggcctgtggg
gtcatcctatacatcctgctggttgggtaccccccattctgggatgaagaccagcaccgc
ctgtaccagcagatcaaggccggcgcctatgatttcccctcaccagaatgggacactgtc
accccagaagccaaggacctcatcaacaagatgctgaccatcaacccgtccaaacgcatc
acggccgccgaggccctcaagcacccctggatctcgcaccggtccactgtggcctcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaacgccaggaggaaactgaag
ggcgccattctcaccaccatgctggctaccaggaacttctctggagggaagagcgcgggg
aacaagaagagcgatggcgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcttcggagagcaccaacaccaccattgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccccgggatgacggccttcgaacccgaggccctggggaacctggtc
gagggcctggacttccatcgattctattttgaaaacttgtggtctcgaaacagcaagccc
gtgcacaccaccatcctgaacccccacatccacctgatgggcgacgagtcggcctgcatt
gcctacatccgcatcacgcaatacctggacgcgggcggcatcccccgcaccgcgcagtcg
gaggagacccgcgtgtggcaccgccgggacggcaagtggcagatcgtccacttccacaga
tcgggggcgccctcggccctgccgcactga

KEGG   Oryctolagus cuniculus (rabbit): 100342451
Entry
100342451         CDS       T03373                                 
Symbol
CAMK2B
Name
(RefSeq) calcium/calmodulin dependent protein kinase II beta
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04012  ErbB signaling pathway
ocu04020  Calcium signaling pathway
ocu04024  cAMP signaling pathway
ocu04066  HIF-1 signaling pathway
ocu04114  Oocyte meiosis
ocu04217  Necroptosis
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04310  Wnt signaling pathway
ocu04360  Axon guidance
ocu04713  Circadian entrainment
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04740  Olfactory transduction
ocu04750  Inflammatory mediator regulation of TRP channels
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04934  Cushing syndrome
ocu04971  Gastric acid secretion
ocu05012  Parkinson disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05031  Amphetamine addiction
ocu05152  Tuberculosis
ocu05200  Pathways in cancer
ocu05205  Proteoglycans in cancer
ocu05214  Glioma
ocu05415  Diabetic cardiomyopathy
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100342451 (CAMK2B)
   04310 Wnt signaling pathway
    100342451 (CAMK2B)
   04066 HIF-1 signaling pathway
    100342451 (CAMK2B)
   04020 Calcium signaling pathway
    100342451 (CAMK2B)
   04024 cAMP signaling pathway
    100342451 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100342451 (CAMK2B)
   04217 Necroptosis
    100342451 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100342451 (CAMK2B)
   04922 Glucagon signaling pathway
    100342451 (CAMK2B)
   04912 GnRH signaling pathway
    100342451 (CAMK2B)
   04921 Oxytocin signaling pathway
    100342451 (CAMK2B)
   04916 Melanogenesis
    100342451 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    100342451 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100342451 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    100342451 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    100342451 (CAMK2B)
   04728 Dopaminergic synapse
    100342451 (CAMK2B)
   04720 Long-term potentiation
    100342451 (CAMK2B)
   04722 Neurotrophin signaling pathway
    100342451 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    100342451 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    100342451 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    100342451 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100342451 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342451 (CAMK2B)
   05205 Proteoglycans in cancer
    100342451 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    100342451 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100342451 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100342451 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100342451 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    100342451 (CAMK2B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100342451 (CAMK2B)
   05415 Diabetic cardiomyopathy
    100342451 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100342451 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100342451 (CAMK2B)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100342451 (CAMK2B)
Protein kinases [BR:ocu01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100342451 (CAMK2B)
SSDB
Motif
Pfam: CaMKII_AD Pkinase PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 100342451
NCBI-ProteinID: XP_017199856
LinkDB
Position
10:complement(44757689..44801073)
AA seq 760 aa
MAGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLEREARICRPFEAFQHCASHDSI
SEEGFHYLVFDLPTSASCASPASGTVTPDAGLVSGSCCGDPRAWEPPGGQRSGWLRCTCW
ALSTSLGLWSLGGGAALRTHRSHAGLEAGQDGPLGPAALRPLRPSVPAVPSPSCLCLAPG
AGVVLPEVGPEQLLPARGHRTGKWSGSTLSPGWWTPWSRGAGAEGGCDWQVDVLGSSECQ
GSSLPCVAGGVVPQEVPRPRPPISGVGGRGHPRAVGSCTVACKDKVGILVQGPLGWDAGV
WGSKTPSSGESRLPLTAWLLCPSLMGQAHAPLSCPAHPLCCTPTCAPHTLAVTSLQPENL
LLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYLSPEVLRKEAYGKPVDIWACGV
ILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDTVTPEAKNLINQMLTINPAKRIT
AHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKLKGAILTTMLATRNFSVGRQTTA
PATMSTGASGTTMGLVEQAKSLLNKKADGVKPQTNSTKNSAAITSPKGTLPPAALEPQTT
VIHNPVDGIKESSDSTNTTIEDEDAKARKQEIIKTTEQLIEAVNNGDFEAYVKICDPGLT
SFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYL
DGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPLQ
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcgggggctttctctgtggtccgacgctgcgtcaagctctgcactggccatgagtac
gcggccaagatcatcaacaccaagaagctgtcggccagagatcaccagaagctggagaga
gaggcaaggatctgccgcccttttgaagcattccaacattgtgcgtctcacgacagcatc
tccgaggagggcttccactacctggtcttcgatctcccaacctcggcttcctgcgcctca
ccagcctcaggcacggtcaccccagatgcagggctggtctcgggcagctgctgcggtgac
ccaagggcctgggagccccctggtggtcagaggtcaggctggctgcggtgcacctgctgg
gctctgagcacctccctgggcctctggtcactgggaggtggtgcggccttgaggacgcac
aggagccatgctggtttggaagctggacaggacggtcccttgggcccagcagccctaaga
cctctcaggccctccgtgccagctgtccccagtcccagctgcctctgccttgcacctgga
gcaggggtggtgctccctgaggtagggcctgagcagcttctccccgcccgtgggcaccgt
acgggcaagtggtcaggcagcactctcagccctgggtggtggactccctggagccggggg
gcgggggcggaagggggctgtgactggcaggtggatgtcctgggctcttctgagtgccaa
ggctcttccttgccctgtgtggcagggggcgttgttccacaggaagtgcctcgtcctcgc
ccccccatatcaggagttggggggagggggcatcccagggctgtgggaagctgcacagtt
gcatgtaaggataaggtggggattttggtccaggggcccctagggtgggatgctggagtg
tggggctccaagactccaagctctggtgaaagccgacttccgctgacagcctggttactg
tgtccatccctgatgggccaggcccatgcacccctctcctgcccagcccaccccctgtgc
tgcacccctacatgtgcacctcacaccctcgcggtgacctccctgcagcccgagaacctg
ctcctggccagcaagtgcaaaggggccgccgtgaagctggccgacttcggcctggccatc
gaagtgcagggggaccagcaggcgtggtttgggtttgcgggcacgcctggctacctgtcc
cctgaggtccttcgcaaggaggcatacggcaagcccgtggacatctgggcatgtggtgtc
atcttgtacattctgctcgtgggctacccgcccttctgggacgaggaccagcacaagctg
taccagcagatcaaggccggggcctacgacttcccatcccccgagtgggacaccgtcact
cccgaagccaaaaacctcatcaaccagatgctgaccatcaaccctgccaagcgcatcacg
gcccacgaggccctgaagcacccgtgggtctgccaacgctccacggtggcctccatgatg
caccggcaggagaccgtggagtgcctgaagaagttcaacgcccgcaggaagctcaaggga
gccatcctcaccaccatgctggccacgcggaatttctcagtgggcagacagaccaccgct
ccggccacaatgtccaccggggcctccggcaccaccatggggctggtggaacaagccaag
agtctactcaacaagaaggcagatggggtcaagccccagacgaacagcaccaaaaacagc
gcggccatcaccagccccaaagggacactccctcccgccgccctggagcctcaaaccacc
gttatccataacccagtggacgggattaaggagtcttccgacagcacgaacaccaccata
gaggatgaggacgccaaagcccggaagcaggagatcatcaagaccacagagcagctcatc
gaagccgtcaacaacggggacttcgaggcctacgtgaagatctgcgacccaggcttgacc
tcgttcgagcccgaagcgctgggcaacctggtggaagggatggacttccacaggttctac
ttcgagaacctgctggccaagaacagcaagcccatccacaccaccatcctgaacccgcac
gtgcacgtgatcggcgaggacgcggcctgcatcgcctacatccgcctcacgcagtacctc
gacgggcagggccggccgcgcaccagccagtcggaggagacgcgcgtgtggcaccgccgc
gacggcaagtggcagaacgtgcatttccactgctcgggcgcgcccgtggccccgctgcag
tga

DBGET integrated database retrieval system