KEGG   Oryctolagus cuniculus (rabbit): 100101579
Entry
100101579         CDS       T03373                                 
Symbol
CCR5, CC-CKR-5, CCR-5, CMKBR5
Name
(RefSeq) C-C motif chemokine receptor 5
  KO
K04180  C-C chemokine receptor type 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03250  Viral life cycle - HIV-1
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04144  Endocytosis
ocu05145  Toxoplasmosis
ocu05163  Human cytomegalovirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    100101579 (CCR5)
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100101579 (CCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100101579 (CCR5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100101579 (CCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100101579 (CCR5)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100101579 (CCR5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100101579 (CCR5)
   05163 Human cytomegalovirus infection
    100101579 (CCR5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100101579 (CCR5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100101579 (CCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100101579 (CCR5)
   04050 Cytokine receptors [BR:ocu04050]
    100101579 (CCR5)
   04090 CD molecules [BR:ocu04090]
    100101579 (CCR5)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100101579 (CCR5)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100101579 (CCR5)
CD molecules [BR:ocu04090]
 Proteins
  100101579 (CCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srab DUF621
Other DBs
NCBI-GeneID: 100101579
NCBI-ProteinID: NP_001164596
Ensembl: ENSOCUG00000003665
UniProt: Q1ZY22
LinkDB
Position
9:14558875..14562859
AA seq 352 aa
MDYSMSTALYDIDYGMSEPCQKIDVKQVAARLLPPLYSLVFIFGFVGNLLVVLILITCKK
LKSMTDIYLLNLAISDLLFLLTLPLWAHYAAAEWDFGGAMCKVFTGMYHMGYFGGIFFII
LLTIDRYLAIVHAVFALKARTVTFGVVTSGVTWVAAILVSLPDIIFTRSQKEGFRCSCSP
HFPASQYQFWKNFHTIMRNILSLVLPLLVMIVCYSGILKTLLRCRNEKRRHRAVRLIFAI
MVVYFLFWAPYNVVLLLNTFQEFFGLNNCSSSNRLDRAMQVTETLGMTHCCINPVVYAFV
GEKFRSYLSAFFRKHVAKRLCKHCPLLPRETPEPASSVYTRSTGEQEISVGL
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggattattcaatgtccactgccctctacgacatcgattatgggatgtcagagccctgc
caaaaaatcgacgtgaagcaggtggcagcccggctcctgcccccactgtattcgctcgtg
ttcattttcggcttcgtgggcaacctgctggtcgtcctcatcctgatcacctgcaagaag
ctgaagagcatgactgacatctacctgctcaacctggccatctccgacctgctcttcctg
ctcaccctcccgctgtgggctcactacgccgccgccgagtgggacttcggaggtgccatg
tgcaaggtgttcacggggatgtatcacatgggctatttcggtggaatcttcttcatcatc
ctcctgaccatcgacaggtacctggctatcgtccacgccgtgtttgccttaaaagccagg
acggtcacctttggggtggtgacaagcggggtcacctgggtggcggccatcttggtgtct
ctcccagacatcatctttaccagatctcaaaaagaaggttttcggtgttcgtgcagccct
cattttccggccagtcagtatcaattttggaagaatttccacaccatcatgaggaacatc
ttgagcctggtcctgccgctgctggtcatgatcgtgtgctactcggggatcctgaaaacc
ctgctgcggtgtcggaacgagaagaggaggcacagggccgtgcggctcatcttcgccatc
atggtggtttacttcctcttctgggcgccctacaacgtcgtcctcctcctgaacaccttc
caggagttcttcggcctgaataactgcagcagctccaacagactggaccgagccatgcag
gtgacggagacgctgggcatgacacactgctgcatcaaccccgtggtctacgccttcgtc
ggggagaagttccggagctacctctccgcgtttttccggaagcacgtcgccaaacgcctc
tgcaaacactgcccgctcctcccgcgggagactccggagccggcgagctcagtgtacacc
cgatccaccggggagcaggagatctctgttggcctgtga

DBGET integrated database retrieval system