KEGG   Oryctolagus cuniculus (rabbit): 100126568
Entry
100126568         CDS       T03373                                 
Symbol
CAPZA2
Name
(RefSeq) capping actin protein of muscle Z-line alpha subunit 2
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100126568 (CAPZA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100126568 (CAPZA2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100126568 (CAPZA2)
   04147 Exosome [BR:ocu04147]
    100126568 (CAPZA2)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100126568 (CAPZA2)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     100126568 (CAPZA2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100126568 (CAPZA2)
SSDB
Motif
Pfam: F-actin_cap_A CCP_MauG
Other DBs
NCBI-GeneID: 100126568
NCBI-ProteinID: NP_001164492
Ensembl: ENSOCUG00000003591
UniProt: Q09YN4
LinkDB
Position
7:complement(28320053..28390918)
AA seq 286 aa
MADLEEQLSDEEKVRIAAKFIIHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNLD
QFTPVKIEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPYEAENAIESW
RSSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQAKNFWNGRWRSEWKFT
VTPSITQVVGILKIQVHYYEDGNVQLVSHKDIQDSLTVSNEAQTAKEFIKIVEAAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
NT seq 861 nt   +upstreamnt  +downstreamnt
atggcggatctggaggagcagttgtctgatgaggagaaggtgcgtatagcagcaaaattc
atcatccatgcccctcctggagaatttaatgaggtatttaatgatgtccggttactgctt
aataatgataatcttctcagggaaggagcagcacatgcatttgcacagtataacttggac
cagtttactccagtaaaaattgaaggttatgaagatcaggtattgataacagaacatggc
gacttggggaatggaaagtttttggatccaaaaaacagaatttgtttcaaatttgatcac
ttgagaaaggaagcaactgatcccagaccctatgaagcagaaaatgcgattgaatcgtgg
agaagttcagtagaaactgctcttcgtgcttatgtaaaagaacattatccgaatggggtc
tgcactgtatatggtaaaaaaattgatggacagcaaaccattattgcatgcatagaaagc
catcagttccaagcaaaaaacttttggaatggtcgttggaggtcagagtggaagtttaca
gtcacaccttcaatcactcaagtggttggcatcttgaaaattcaggttcattattatgaa
gatggtaatgttcagctagtgagtcataaagatatacaagattccctaacagtgtctaat
gaggcacaaacagcaaaagaatttataaaaattgtagaagctgcagaaaatgagtaccag
actgccatcagtgagaattatcagacaatgtcggacactactttcaaagccttacgtcga
cagttgccagttacacgcactaagattgattggaacaagatccttagctacaagattggc
aaagagatgcagaatgcataa

KEGG   Oryctolagus cuniculus (rabbit): 100349335
Entry
100349335         CDS       T03373                                 
Symbol
CAPZA1
Name
(RefSeq) capping actin protein of muscle Z-line alpha subunit 1
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349335 (CAPZA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100349335 (CAPZA1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100349335 (CAPZA1)
   04147 Exosome [BR:ocu04147]
    100349335 (CAPZA1)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100349335 (CAPZA1)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     100349335 (CAPZA1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100349335 (CAPZA1)
SSDB
Motif
Pfam: F-actin_cap_A CCP_MauG
Other DBs
NCBI-GeneID: 100349335
NCBI-ProteinID: XP_002715812
Ensembl: ENSOCUG00000000270
UniProt: G1SCY4
LinkDB
Position
13:complement(51485035..51537539)
AA seq 286 aa
MADFEDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEVDGGLKSW
RESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSITVSNEIQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
NT seq 861 nt   +upstreamnt  +downstreamnt
atggccgacttcgaggatcgggtgtcggatgaggagaaggtacgcatagctgctaaattc
atcactcatgcacccccaggagaatttaatgaagtattcaatgatgtccgactactactt
aataatgacaatctcctcagggaaggggcagcacatgcatttgcccagtataacatggat
cagttcacgcctgtgaagatagaaggatatgaagatcaggtcttaattacagagcacggt
gacctgggtaatagcagatttttagatccaagaaacaaaatttcctttaagtttgatcac
ttacggaaagaagcaagtgatccccagccagaggaagtagatggaggcttgaagtcgtgg
agagaatcctgtgacagtgctttgagagcctatgtgaaagatcattattccaacggcttc
tgtactgtgtatgctaaaactatagatgggcagcagactattattgcatgtattgaaagc
caccaatttcagcctaaaaacttctggaatggtcgttggagatcagagtggaaattcacc
atcacaccacctacagcccaagtggttggagtgcttaagattcaggttcactattacgaa
gacggcaatgttcagttggttagtcataaagatgtacaagactcaataactgtgtcgaat
gaaatacaaactgccaaggagtttattaaaatcatagagaatgcagaaaatgaatatcag
acagcaattagtgaaaactatcaaaccatgtcagacaccacattcaaggccttgcgccgg
caacttccagttacccgcaccaaaatcgactggaacaagatactcagctacaagattggc
aaagaaatgcagaatgcttaa

KEGG   Oryctolagus cuniculus (rabbit): 100351873
Entry
100351873         CDS       T03373                                 
Name
(RefSeq) F-actin-capping protein subunit alpha-1-like
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351873
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351873
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100351873
   04147 Exosome [BR:ocu04147]
    100351873
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100351873
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     100351873
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100351873
SSDB
Motif
Pfam: F-actin_cap_A CCP_MauG
Other DBs
NCBI-GeneID: 100351873
NCBI-ProteinID: XP_017194668
UniProt: A0A5F9D8J8
LinkDB
Position
Un
AA seq 286 aa
MADFEDRVSDEEKVCIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITKHGDLGNSRFLDPRNKISFKFDHLWKEASDPQPEEVDGGLKSW
RESCDSALRAYVKDHYSNGFCAVYAKTIDGQQTIIACIESHQFQPKNFWNSRWRSAWKFT
MTPPIAQVVGVLKIQVHYFEDGNVQLVSHKDVQDSVTVLNEIQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKVDWNKILSYKIGKEMQNA
NT seq 861 nt   +upstreamnt  +downstreamnt
atggccgacttcgaggatcgggtgtcggatgaggagaaggtatgcatagctgctaaattc
atcactcatgcacccccaggagaatttaatgaagtattcaatgatgtccgactactactt
aataatgacaatctcctcagggaaggggcagcacatgcatttgcccagtataacatggat
cagttcacgcctgtgaagatagaaggatatgaagatcaggtcttaattacaaagcacggt
gacctgggtaatagcagatttttagatccaagaaacaaaatttcctttaagtttgatcac
ttatggaaagaagcaagtgatccccagccagaggaagtagatggaggcttgaagtcgtgg
agagaatcctgtgacagtgctttgagagcctatgtgaaagatcattattccaacggattc
tgtgctgtgtatgctaaaactatagatgggcagcagactattattgcatgtattgaaagc
caccaatttcagcctaaaaacttctggaacagtcgttggagatcagcctggaaattcacc
atgacaccacctatagcccaagtggttggagtgcttaagattcaggttcactatttcgaa
gacggcaatgttcagttggttagtcataaagatgtacaagactcagtaactgtgttgaat
gaaatacaaactgccaaggagtttattaaaatcatagagaatgcagaaaatgaatatcag
acagcaattagtgaaaactatcaaaccatgtcagacaccacattcaaggccttgcgccgg
caacttccagttacccgcaccaaagtcgattggaacaagatactcagctacaagattggc
aaagaaatgcagaatgcttaa

KEGG   Oryctolagus cuniculus (rabbit): 100358093
Entry
100358093         CDS       T03373                                 
Symbol
CAPZA3
Name
(RefSeq) capping actin protein of muscle Z-line alpha subunit 3
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358093 (CAPZA3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358093 (CAPZA3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100358093 (CAPZA3)
   04147 Exosome [BR:ocu04147]
    100358093 (CAPZA3)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Others
   WASH complex
    100358093 (CAPZA3)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     100358093 (CAPZA3)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100358093 (CAPZA3)
SSDB
Motif
Pfam: F-actin_cap_A
Other DBs
NCBI-GeneID: 100358093
NCBI-ProteinID: XP_002712784
Ensembl: ENSOCUG00000014673
UniProt: G1T7V9
LinkDB
Position
8:complement(21162825..21163878)
AA seq 299 aa
MALSVLSRKEKERVIRRLLIQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYS
VPLSIDGNAVLLSHHNVIGDYRFFDYQSKLSFKFDLLQNQLKDIQSHGIIRNETEYLRTV
VLCALKLYVNDHYPTGNCNVLRKTIKSKEFLIACIEDHNYETGDCWNGLWKSKWIFQVNP
FLTQVTGRIFVQAHYFRCVNLHVEISKDLKESLEVVNQAQLALSFARLVEEQENKFQAAV
LEELQELSNEALRRILRRDLPVTRTLIDWQRILSDLNLVMYPKLGYVIYSRSVLCNWII
NT seq 900 nt   +upstreamnt  +downstreamnt
atggcacttagcgttctgagtaggaaggagaaagaaagagtaattcgcagactgttgata
caggctccgccaggggaatttgtaaatgcctttgatgatctctgtctgctcatccgagat
gaaaaactgatgcaccatcaaggtgagtgtgcaggacaccagcattgccaaaaatactcc
gtcccgctcagcattgatgggaacgcagtactcctgtcccaccacaacgtcattggggac
taccgattttttgactatcaaagcaaactttctttcaaatttgacctgcttcaaaaccag
ctgaaagacatccaaagtcacgggatcattcgtaatgagacagagtacctgagaactgtt
gttttatgtgccttgaaactgtatgtgaatgatcactatccaacaggaaactgtaacgta
ctgaggaaaaccatcaagagtaaggaattcttgatagcttgcattgaggatcacaactat
gaaacaggagactgctggaatggcctttggaaatctaaatggattttccaagtaaatcca
tttctaacccaagtaacaggaagaatcttcgtgcaagctcactacttcaggtgtgtcaac
cttcatgtggaaatttccaaagatctcaaagaaagcttggaagtggttaaccaagcacaa
ctggctctaagttttgcaaggcttgtggaagaacaagagaataaatttcaagctgccgtc
ttagaagaattacaggagttatcaaatgaggccctgcgaagaattcttcgaagggatctt
ccagtgacccgcactcttattgactggcagaggatactctctgacctgaatctggtgatg
tatcctaaactaggatatgtcatttattccagaagtgttctgtgcaactggataatataa

DBGET integrated database retrieval system