KEGG   Oryctolagus cuniculus (rabbit): 100144329
Entry
100144329         CDS       T03373                                 
Symbol
CCR9
Name
(RefSeq) C-C motif chemokine receptor 9
  KO
K04184  C-C chemokine receptor type 9
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144329 (CCR9)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100144329 (CCR9)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100144329 (CCR9)
   04062 Chemokine signaling pathway
    100144329 (CCR9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100144329 (CCR9)
   04050 Cytokine receptors [BR:ocu04050]
    100144329 (CCR9)
   04090 CD molecules [BR:ocu04090]
    100144329 (CCR9)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100144329 (CCR9)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100144329 (CCR9)
CD molecules [BR:ocu04090]
 Proteins
  100144329 (CCR9)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100144329
NCBI-ProteinID: XP_008258733
Ensembl: ENSOCUG00000008210
UniProt: G1SUQ1
LinkDB
Position
9:14238994..14252007
AA seq 369 aa
MTPTEFASLIPNMSDDYSYDATSSIDEYMAFNFTDLFCKKSNVRQFASYFLPPLYWLVFI
AGTVGNSLVVLVYWYCTRVKTMTDMFLLNLAIADLLFLATLPFWAIAAADQWQFQTFLCK
VVNSMYKMNFYSCVLLITCVSVDRYIAIAQAMRAQIWRQKRLLYSKLVCFAVWVMAAALC
IPELLYSQIRKESGISMCTMVYPRDESTKLKSLVLTLKVILGFFLPFVVMACCYTIIIRT
LTQAKKSSKHKALKVTIAVLTVFVLSQFPYNCILLLQTIDAYVMFISSCAFSINIDICFQ
VTQTIAFFHSCLNPVLYVFVGERFRRDLVKTLKNLGCISHAQWVSFTRREGSLKLSSMLL
ETTSGALSL
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgacccccacggaattcgcaagccttattcccaatatgtctgatgactacagctatgac
gccacgtcttccatagacgagtacatggccttcaacttcaccgacctcttctgtaagaaa
agcaacgtcaggcagttcgcgagctacttcctgccccccttgtactggctggtctttatc
gcaggcactgtgggtaacagtctggttgttctcgtctactggtactgcacgagggtcaag
accatgaccgacatgttcctcctgaacctggcgattgctgacctgctctttctggccacg
ctccccttctgggccatcgccgccgctgaccagtggcaattccagaccttcctgtgcaaa
gtggtcaacagcatgtacaagatgaacttctacagctgtgtgctgctcatcacgtgcgtc
agcgtggacaggtacatcgccatcgcgcaggccatgcgagcccagatctggaggcagaaa
cggcttctctacagcaagctggtttgctttgcagtctgggtgatggcggctgcactgtgc
atcccagagctcctgtacagccaaatcaggaaggaatcgggcatcagcatgtgcaccatg
gtttacccccgggacgagagcaccaaactcaagtcccttgtcttgaccctgaaggtcatc
ctgggcttcttcctcccctttgtggtcatggcttgctgctacaccattatcatccgcacc
ctgacccaagccaagaagtcctccaaacacaaggccctgaaggtgaccatcgcggtcctg
accgtcttcgtcttgtctcagttcccgtacaactgcatcctgctgctgcagaccatcgac
gcctacgtcatgttcatctccagctgtgccttttccatcaacattgacatctgcttccag
gtcactcagaccatcgccttcttccacagttgcctgaatcccgttctctacgttttcgtg
ggcgagaggttccgccgagatctcgtgaaaaccctcaagaacctggggtgcatcagccac
gcccagtgggtttcattcacaaggagagaggggagcttgaagctgtcatcaatgctgctg
gagacaacctctggagccctctccctctga

DBGET integrated database retrieval system