KEGG   Oryctolagus cuniculus (rabbit): 100144330
Entry
100144330         CDS       T03373                                 
Symbol
CCR10
Name
(RefSeq) C-C motif chemokine receptor 10
  KO
K04185  C-C chemokine receptor type 10
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144330 (CCR10)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100144330 (CCR10)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100144330 (CCR10)
   04062 Chemokine signaling pathway
    100144330 (CCR10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100144330 (CCR10)
   04050 Cytokine receptors [BR:ocu04050]
    100144330 (CCR10)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100144330 (CCR10)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100144330 (CCR10)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 100144330
NCBI-ProteinID: XP_002719452
UniProt: G1TU43
LinkDB
Position
19:complement(43407937..43410093)
AA seq 362 aa
MGTEPTEQASWGPYSGEEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNG
LVLATHLAARRTARSPTSAHLLQLALADLLLALTLPFAAVGVLQGWNLGSTTCRAISGLY
SASFHAGFLFLACISADRYVAIARALPAGPRPSAPGRAHLVTVIVWLLALLLALPALLFS
RDGQREGQRRCRLIFPEGLAQTVKGASAVAQVALGFALPLGVMAACYALLGRTLLAARGP
ERRRALRVVVALVAAFVVLQLPYSLALLLDTADFLAARERSCPASKRKDLALLVTGGLAL
ARCGLNPVLYAFLGLRFRQDLRRLLRGGGCGPGPRARSRCPRRPRLSSCSAPTETHSLSW
DH
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggggacggagcccacagagcaggcttcctggggcccctactcgggagaggaggaggac
gcgtactccgccgagccactgccggaactctgctacaaggccgatgtccaggccttcagc
cgagccttccagcccagcgtctccctgaccgtggctgcgctgggtctggctggcaacggc
ctggtcctggccacccacctggcggcccgacggaccgcccgctcgcccacctccgcccac
ctgctgcagctggccctggccgacctcctgctggccttgaccctgccttttgccgcagtg
ggggttcttcagggctggaatctcggaagtacgacctgccgcgccatctccggcctctac
tcggcctccttccacgccggcttcctcttcctggcctgcatcagcgcggaccgctacgtg
gccatcgcgagggcgcttccagctgggccccggccctccgcgccaggccgtgcgcacttg
gtcacagtcatcgtgtggctgctggcgcttctcctggcgctgcccgcgctcctcttcagc
cgggacgggcagcgggaaggccagcggcgctgtcgcctcatcttccccgagggcctcgca
cagacagtgaagggggcaagcgccgtggcgcaggtggccctgggcttcgcgctgccgctg
ggcgtcatggcggcctgttacgcgctcctgggccgcacgctgctggccgccagggggccc
gagcgccggcgcgcgctgcgcgtcgtggtggccctggtggccgccttcgtggtgctgcag
ctgccctatagcctcgccctgttgctggacacggccgatttcctggccgcgcgcgagcgg
agctgccctgccagcaagcgcaaggatctggcgctgctggtcaccggcggcttggccttg
gcccgctgcggcctcaatcccgtgctctacgcctttctgggcctgcgcttccgccaggac
ctgcggaggttgctgcgcggtgggggctgcggcccagggcctcgtgcccgcagccgctgc
ccccgccggccccgcctttcttcctgctctgcccccaccgagacccacagcctctcttgg
gaccactag

DBGET integrated database retrieval system