KEGG   Oryctolagus cuniculus (rabbit): 100144335
Entry
100144335         CDS       T03373                                 
Symbol
CXCR5
Name
(RefSeq) C-X-C motif chemokine receptor 5
  KO
K04190  C-X-C chemokine receptor type 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100144335 (CXCR5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100144335 (CXCR5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100144335 (CXCR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100144335 (CXCR5)
   04050 Cytokine receptors [BR:ocu04050]
    100144335 (CXCR5)
   04090 CD molecules [BR:ocu04090]
    100144335 (CXCR5)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100144335 (CXCR5)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CXC Chemokine
   100144335 (CXCR5)
CD molecules [BR:ocu04090]
 Proteins
  100144335 (CXCR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF4059
Other DBs
NCBI-GeneID: 100144335
NCBI-ProteinID: XP_002722748
Ensembl: ENSOCUG00000025048
UniProt: G1TNG1
LinkDB
Position
Un
AA seq 374 aa
MNYPMTLDVDLLNYNLEDVYKEFLNYNDSTEPTQLESHFCSSAEGPLLSSFKAVFMPVAY
SLIFLLGMLGNILVLVILERHRQTRSSTETFLFHLAVADLLLVFILPFAVAEGSVGWVLG
TFLCKTVIALHKINFYCSSLLLACIAVDRYLAIVHAVHAYRHRRLLSIHITCATVWLAGF
LFALPEILFAKVSRPHHNDSLPRCTFSQENQAETNAWFISRFLYHVGGFLLPMLVMGWCY
VGVVHRLCQAQRRPQRQKAVRVAILVTSIFFLCWSPYHVVIFLDTLARLKAVGNSCELHG
SLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCAGPASLCQLFPSWRKS
SLSESENATSLTTF
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaactaccccatgaccctggatgtggacctcttgaactacaatctggaggacgtgtac
aaggaattcctcaactacaatgacagcacggagcccacgcaactggaaagccacttctgc
tccagcgccgaggggcccctcctgagctccttcaaggctgtgttcatgcccgtggcctac
agtctcatcttcctcctgggcatgctgggcaacatccttgtgctggtgatcctggagagg
caccggcagactcgcagctccaccgagaccttcctcttccacctggccgtggccgacctg
ctgctcgtcttcatcctgcccttcgccgtggccgagggctccgtgggctgggtcctgggg
accttcctctgcaaaacggtgatcgctctgcacaagatcaacttctactgcagcagcctg
ctcctggcctgcatcgctgtcgaccgctacctggccatcgtccacgccgtgcatgcctac
cgccaccgccgcctcctctccatccacatcacctgcgccactgtctggctggcgggcttc
ctctttgccttgccagagattctcttcgccaaggtcagccggccccaccacaacgactcc
ctgccacgctgcaccttctcccaggagaaccaagccgagaccaacgcctggttcatctcc
cgcttcctctaccacgtcgggggcttcctgctgccgatgctggtgatgggctggtgctac
gtgggcgtggtgcacaggctgtgccaggcccagaggcgccctcagcggcagaaggcagtc
agggtggccatcctggtgaccagcatcttcttcctctgctggtcgccctaccacgttgtc
atcttcctggacaccctggccaggctgaaggccgtgggcaacagctgcgagctgcacggc
tctctgccggtggccatcaccatgtgcgagttcctgggcctggcccactgctgcctcaac
cccatgctttacacctttgccggcgtgaagttccgcagcgacctctctcggcttctgacc
aagctgggctgcgccggccccgcctccctgtgccagctcttccccagctggcgcaagagc
agcctctccgagtccgagaacgccacctccctcaccaccttctag

DBGET integrated database retrieval system