KEGG   Oryctolagus cuniculus (rabbit): 100303767
Entry
100303767         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 28
  KO
K05513  C-C motif chemokine 28
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100303767
   04061 Viral protein interaction with cytokine and cytokine receptor
    100303767
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100303767
   04062 Chemokine signaling pathway
    100303767
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100303767
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100303767
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100303767
NCBI-ProteinID: XP_002714062
Ensembl: ENSOCUG00000007934
LinkDB
Position
11:complement(64228171..64238906)
AA seq 126 aa
MQCAGLLLVALATCVALQPSEAILPFFSSCCTEVSPHLSRRLLKMVHTCHLQRADGDCDL
DAVALYFGRRRFCVTTENHMLKEWMKAQAAKKIGQRIICREKKYNKSSSRGTSVEGSMTG
CHKTSS
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcagtgcgcaggactcttgctggtggccttggctacctgtgtggctcttcaaccctca
gaagccatattgccctttttctccagctgttgcactgaggtttcaccacacctttccaga
aggcttctgaagatggttcatacatgtcacctgcagagagctgatggggactgtgacttg
gatgctgtcgccctttatttcgggcgcagaagattctgtgttaccacagagaatcatatg
cttaaggaatggatgaaagcacaagcagccaagaaaattggtcaacgcataatttgccgc
gagaagaagtataataagagttcatcaaggggcacgtcagtggagggttccatgacgggc
tgccataagacttcttcctag

KEGG   Oryctolagus cuniculus (rabbit): 100343840
Entry
100343840         CDS       T03373                                 
Symbol
CCL7
Name
(RefSeq) chemokine (C-C motif) ligand 7
  KO
K05509  C-C motif chemokine 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100343840 (CCL7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100343840 (CCL7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100343840 (CCL7)
   04062 Chemokine signaling pathway
    100343840 (CCL7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100343840 (CCL7)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100343840 (CCL7)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100343840
NCBI-ProteinID: NP_001284411
UniProt: J7I290
LinkDB
Position
19:23731547..23733738
AA seq 99 aa
MQISAALLCLLLTVAAFSSQVLAQPEGTNSGKTCCYRFHNRRMDPQKLRSYTLISISYCP
REAVIFKTKQHREVCADPKWPWAQNAIAYLNKKTQTSKP
NT seq 300 nt   +upstreamnt  +downstreamnt
atgcaaatctctgcrgcacttctgtgcctgctgctcacagtggctgccttcagctcccag
gtgcttgcccagccagaagggactaacagcggcaaaacctgctgctacagattccacaac
aggaggatggacccgcagaagctgaggagctacacactcatcagcatcagctactgtccc
cgggaagctgtgatcttcaagaccaaacagcaccgagaggtctgtgctgaccccaagtgg
ccatgggcccaaaatgccattgcctacctgaacaagaaaactcagacttcaaagccttga

KEGG   Oryctolagus cuniculus (rabbit): 100348266
Entry
100348266         CDS       T03373                                 
Symbol
CCL5
Name
(RefSeq) C-C motif chemokine ligand 5
  KO
K12499  C-C motif chemokine 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04668  TNF signaling pathway
ocu05020  Prion disease
ocu05142  Chagas disease
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
ocu05323  Rheumatoid arthritis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100348266 (CCL5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348266 (CCL5)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348266 (CCL5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100348266 (CCL5)
   04621 NOD-like receptor signaling pathway
    100348266 (CCL5)
   04623 Cytosolic DNA-sensing pathway
    100348266 (CCL5)
   04062 Chemokine signaling pathway
    100348266 (CCL5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100348266 (CCL5)
   05168 Herpes simplex virus 1 infection
    100348266 (CCL5)
   05163 Human cytomegalovirus infection
    100348266 (CCL5)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100348266 (CCL5)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100348266 (CCL5)
  09164 Neurodegenerative disease
   05020 Prion disease
    100348266 (CCL5)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100348266 (CCL5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348266 (CCL5)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100348266 (CCL5)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348266 (CCL5)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   100348266 (CCL5)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348266
NCBI-ProteinID: XP_017204526
Ensembl: ENSOCUG00000002848
UniProt: G1SIG1
LinkDB
Position
19:complement(24923608..24932154)
AA seq 91 aa
MEVSAAALAVLLTAAALCAPASASPYASDTTPCCFAYISRLLPRAHVTEYFYTSGKCSFP
AVVFVTRKNRQVCANPEKKWVREYINSLEMS
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaggtctccgccgccgccctcgccgtcctcctcaccgctgctgccctctgcgcacct
gcatctgcctccccatatgcctcggacaccacgccctgctgctttgcctacatctcccgc
ctgctgccccgggcccacgtcacggagtatttctataccagcggcaagtgctccttcccg
gcagttgtctttgtcaccaggaagaaccgccaggtgtgtgccaacccagagaagaaatgg
gttcgggagtacatcaactctttggagatgagctaa

KEGG   Oryctolagus cuniculus (rabbit): 100348869
Entry
100348869         CDS       T03373                                 
Symbol
CCL27
Name
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348869 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348869 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100348869 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348869 (CCL27)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348869 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348869
NCBI-ProteinID: XP_002707984
Ensembl: ENSOCUG00000001224
UniProt: A0A5F9CTF0
LinkDB
Position
1:19161806..19163369
AA seq 121 aa
MEGCSPTSRLLLLLLLLSLDPGAVLILPPSTTCCTQLYRQPLSNKLLRKVIRVELQEADG
DCHLQAFVLHLARRSVCIHPQNRSLARWFERQGKRLQGTQPDFWVARENGLEPHKAPIKQ
H
NT seq 366 nt   +upstreamnt  +downstreamnt
atggaggggtgttcacctaccagcaggctcctgctgctgctgttgctcctgagcctggac
cctggagcagtgttgatactgccacccagcactacctgctgtactcagctctaccgacag
ccactgtcaaacaagctactgaggaaggtcatccgggtggaactgcaggaggctgatgga
gactgtcacctgcaggctttcgtgcttcatctggctcgacgcagcgtgtgcattcatccc
cagaaccgcagcctggctcggtggttcgagcgccaagggaagaggctccaggggactcaa
cctgatttctgggttgctagggaaaatgggttggagccccacaaagccccaataaagcaa
cattag

KEGG   Oryctolagus cuniculus (rabbit): 100354652
Entry
100354652         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 24
  KO
K21097  C-C motif chemokine 24
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100354652
   04061 Viral protein interaction with cytokine and cytokine receptor
    100354652
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100354652
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100354652
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100354652
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100354652
NCBI-ProteinID: XP_002723161
Ensembl: ENSOCUG00000021311
LinkDB
Position
Un
AA seq 113 aa
MAGPATIAASLLLLALSAHHFTPAGTVVIPSSCCMNFIPKKIPESQVVSYQLSSGSVCPR
AGVIFTTKKDYRVCGDPKQQWVQSYVRDLVAKWRRPSTGARTPGSRRPGEMRA
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcaggccctgcaaccatcgcagccagcctcctgctgctggccctcagtgcccaccac
ttcacccctgcaggcaccgtggtcatcccctcctcctgctgcatgaactttattcctaag
aagatccctgagagccaagtggtgagctaccagctgtccagcgggagtgtctgccccagg
gcaggtgtgatcttcaccaccaagaaggactaccgagtctgcggcgaccccaagcagcag
tgggtgcagagctatgtgagggacctggttgccaagtggaggaggccttccacgggggcc
agaacgccaggcagcagacgtcccggagagatgcgtgcttga

KEGG   Oryctolagus cuniculus (rabbit): 100355784
Entry
100355784         CDS       T03373                                 
Symbol
CCL24
Name
(RefSeq) C-C motif chemokine ligand 24
  KO
K21097  C-C motif chemokine 24
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100355784 (CCL24)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100355784 (CCL24)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100355784 (CCL24)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100355784 (CCL24)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100355784 (CCL24)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100355784
NCBI-ProteinID: XP_002711955
Ensembl: ENSOCUG00000025061
UniProt: G1SCU3
LinkDB
Position
6:26989613..26991642
AA seq 113 aa
MAGPATIAASLLLLALSAHHFTPAGAVVIPSSCCMNFIPKKIPESQVVSYQLSSGSVCPR
AGVIFTTKKGYRVCGDPKQQWVQSYVRNLVAKRRKPSTGARAPGGRRPGEMRA
NT seq 342 nt   +upstreamnt  +downstreamnt
atggcaggccctgcaaccatcgcagccagcctcctgctgctggccctcagtgcccaccac
ttcacccctgcaggtgctgtggtcatcccctcctcctgctgcatgaactttattcctaag
aagatccctgagagccaagtggtgagctaccagctgtccagcgggagtgtctgccccagg
gcaggtgtgatcttcaccaccaagaagggctaccgagtctgcggcgaccccaagcagcag
tgggtgcagagctatgtgaggaacctggttgccaagcggaggaagccttccacgggggcc
agagctccaggcggcagacgtcccggagagatgcgagcttga

KEGG   Oryctolagus cuniculus (rabbit): 103349663
Entry
103349663         CDS       T03373                                 
Symbol
CCL28
Name
(RefSeq) C-C motif chemokine ligand 28
  KO
K05513  C-C motif chemokine 28
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349663 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103349663 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103349663 (CCL28)
   04062 Chemokine signaling pathway
    103349663 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103349663 (CCL28)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103349663 (CCL28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103349663
NCBI-ProteinID: XP_008260555
LinkDB
Position
11:complement(64146002..64175044)
AA seq 122 aa
MHVRLSLLSPTQRTILPFASSCCTKVSPHVSRKLLKVVRACHLQRADGDCNLDAVILHVR
HRRYCIAPENHTLKEWMKAQAVKENDRRKICHKKKYIKRNHEGARRGKHVTGGHKTYQTV
DA
NT seq 369 nt   +upstreamnt  +downstreamnt
atgcacgtaaggctgagtttactgagtcccacccaacgtaccatactgccctttgcctcc
agctgttgcactaaggtttcaccacacgtttccagaaagcttctgaaagtggtgcgtgca
tgtcatctgcagagagctgatggcgactgtaacttggatgctgtcatccttcatgtccgg
cacagaagatactgtatcgctccagagaatcatactcttaaggagtggatgaaagcacaa
gcagtcaaggaaaatgacagacgcaaaatctgccataagaagaaatacatcaagaggaac
catgaaggggcacgtcggggaaagcatgtgacaggtggccataaaacttaccagacagtt
gatgcctaa

KEGG   Oryctolagus cuniculus (rabbit): 103351522
Entry
103351522         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 23
  KO
K05511  C-C motif chemokine 15/23
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351522
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351522
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351522
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351522
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351522
SSDB
Motif
Pfam: IL8 MC3 ESF1
Other DBs
NCBI-GeneID: 103351522
NCBI-ProteinID: XP_008269360
Ensembl: ENSOCUG00000000686
LinkDB
Position
19:complement(24980990..24987111)
AA seq 125 aa
MKVSVAALSFLALILAAALGSQALVTHDTDTKQLALVVDRFDKEIVQGFHRPTDCCFSYT
KRNIQCFLMQDYIETSSQCSMPAVIFLTKRGQKVCADSSDERVRKCVSSLQRDLPTRNLG
IVALA
NT seq 378 nt   +upstreamnt  +downstreamnt
atgaaggtctccgtggctgccctctccttcctcgccctcatccttgcagctgccctgggc
tcgcaggccctggtcacacatgatacagacacaaaacagctcgccttggtggtggataga
tttgataaagaaatcgtccaaggcttccaccgccctacagactgctgcttctcctacaca
aaacgaaacatccagtgcttcctcatgcaagattatattgagaccagcagtcagtgctcc
atgccagctgtcatcttcctcaccaagaggggacaaaaagtgtgtgctgactccagtgat
gagagagtccggaagtgtgtgtcaagcctgcaaagggacctgccgaccaggaatctagga
atagtggcactggcttga

KEGG   Oryctolagus cuniculus (rabbit): 103351523
Entry
103351523         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 15
  KO
K05511  C-C motif chemokine 15/23
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351523
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351523
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    103351523
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103351523
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103351523
SSDB
Motif
Pfam: IL8 Chlam_OMP3
Other DBs
NCBI-GeneID: 103351523
NCBI-ProteinID: XP_008269362
Ensembl: ENSOCUG00000029281
LinkDB
Position
19:complement(24971837..24977356)
AA seq 138 aa
MKLSTAALSLLLLAAVLGTQAFVLHNTETRQLTRAMDRLINRRPIQGVNPIQSIMPLSSN
VRPSDCCYGYTTRPLQCSVMEDFFETNSQCSMPAVIFITKCGKLICANPRNNEVEECMET
LKTQGTRLGPRAAAGLLY
NT seq 417 nt   +upstreamnt  +downstreamnt
atgaagctctccacggctgccctctccctcctcctccttgctgctgtccttggcacccag
gccttcgtcttgcacaatacagagacgagacagctcaccagggcgatggacaggcttatt
aatagaagacccatccaaggtgtaaaccctatacaatcaatcatgcctctatcttcaaat
gtgcgtcctagtgactgctgctatggctacaccacacgacccctccagtgttcagttatg
gaagatttctttgagaccaacagtcagtgctccatgccagctgtcatcttcatcactaaa
tgtggaaaactgatctgtgccaaccccagaaataatgaagttgaagaatgcatggaaacc
ctgaagacccagggaaccagattaggccccagggcagcagcagggttgctttactaa

KEGG   Oryctolagus cuniculus (rabbit): 107546750
Entry
107546750         CDS       T03373                                 
Symbol
CCL11
Name
(RefSeq) chemokine (C-C motif) ligand 11
  KO
K16597  C-C motif chemokine 11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04657  IL-17 signaling pathway
ocu05310  Asthma
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107546750 (CCL11)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107546750 (CCL11)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107546750 (CCL11)
   04062 Chemokine signaling pathway
    107546750 (CCL11)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107546750 (CCL11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    107546750 (CCL11)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   107546750 (CCL11)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 107546750
NCBI-ProteinID: NP_001309361
Ensembl: ENSOCUG00000005935
UniProt: G1SPZ3
LinkDB
Position
19:23739202..23742061
AA seq 96 aa
MKVSAALLCMLVTAAVFSSQVLAQPAFVPTTCCFSMAKKMPLQRLESYRRISGSKCPQKA
VIFKTKLAKEICADPKEKWVQDSIKYLDQKSKTSKP
NT seq 291 nt   +upstreamnt  +downstreamnt
atgaaggtctctgcagcacttctctgcatgctggtcacggcggctgttttcagctcccag
gtgcttgctcagccagcttttgtcccaaccacttgctgcttctctatggccaagaagatg
cccctccagcggctggagagctacagaagaatcagtggcagcaaatgcccccagaaagct
gtgatcttcaagaccaagttggccaaggagatctgtgctgaccccaaggagaagtgggtc
caagattctataaaatacctggaccaaaaatccaaaacttcaaagccatag

DBGET integrated database retrieval system