KEGG   Oryctolagus cuniculus (rabbit): 100303767
Entry
100303767         CDS       T03373                                 
Name
(RefSeq) C-C motif chemokine 28
  KO
K05513  C-C motif chemokine 28
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100303767
   04061 Viral protein interaction with cytokine and cytokine receptor
    100303767
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100303767
   04062 Chemokine signaling pathway
    100303767
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100303767
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100303767
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100303767
NCBI-ProteinID: XP_002714062
Ensembl: ENSOCUG00000007934
LinkDB
Position
11:complement(64228171..64238906)
AA seq 126 aa
MQCAGLLLVALATCVALQPSEAILPFFSSCCTEVSPHLSRRLLKMVHTCHLQRADGDCDL
DAVALYFGRRRFCVTTENHMLKEWMKAQAAKKIGQRIICREKKYNKSSSRGTSVEGSMTG
CHKTSS
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcagtgcgcaggactcttgctggtggccttggctacctgtgtggctcttcaaccctca
gaagccatattgccctttttctccagctgttgcactgaggtttcaccacacctttccaga
aggcttctgaagatggttcatacatgtcacctgcagagagctgatggggactgtgacttg
gatgctgtcgccctttatttcgggcgcagaagattctgtgttaccacagagaatcatatg
cttaaggaatggatgaaagcacaagcagccaagaaaattggtcaacgcataatttgccgc
gagaagaagtataataagagttcatcaaggggcacgtcagtggagggttccatgacgggc
tgccataagacttcttcctag

KEGG   Oryctolagus cuniculus (rabbit): 100348869
Entry
100348869         CDS       T03373                                 
Symbol
CCL27
Name
(RefSeq) C-C motif chemokine ligand 27
  KO
K16598  C-C motif chemokine 27
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100348869 (CCL27)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100348869 (CCL27)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100348869 (CCL27)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100348869 (CCL27)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100348869 (CCL27)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100348869
NCBI-ProteinID: XP_002707984
Ensembl: ENSOCUG00000001224
UniProt: A0A5F9CTF0
LinkDB
Position
1:19161806..19163369
AA seq 121 aa
MEGCSPTSRLLLLLLLLSLDPGAVLILPPSTTCCTQLYRQPLSNKLLRKVIRVELQEADG
DCHLQAFVLHLARRSVCIHPQNRSLARWFERQGKRLQGTQPDFWVARENGLEPHKAPIKQ
H
NT seq 366 nt   +upstreamnt  +downstreamnt
atggaggggtgttcacctaccagcaggctcctgctgctgctgttgctcctgagcctggac
cctggagcagtgttgatactgccacccagcactacctgctgtactcagctctaccgacag
ccactgtcaaacaagctactgaggaaggtcatccgggtggaactgcaggaggctgatgga
gactgtcacctgcaggctttcgtgcttcatctggctcgacgcagcgtgtgcattcatccc
cagaaccgcagcctggctcggtggttcgagcgccaagggaagaggctccaggggactcaa
cctgatttctgggttgctagggaaaatgggttggagccccacaaagccccaataaagcaa
cattag

KEGG   Oryctolagus cuniculus (rabbit): 103349663
Entry
103349663         CDS       T03373                                 
Symbol
CCL28
Name
(RefSeq) C-C motif chemokine ligand 28
  KO
K05513  C-C motif chemokine 28
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349663 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103349663 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103349663 (CCL28)
   04062 Chemokine signaling pathway
    103349663 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103349663 (CCL28)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103349663 (CCL28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103349663
NCBI-ProteinID: XP_008260555
LinkDB
Position
11:complement(64146002..64175044)
AA seq 122 aa
MHVRLSLLSPTQRTILPFASSCCTKVSPHVSRKLLKVVRACHLQRADGDCNLDAVILHVR
HRRYCIAPENHTLKEWMKAQAVKENDRRKICHKKKYIKRNHEGARRGKHVTGGHKTYQTV
DA
NT seq 369 nt   +upstreamnt  +downstreamnt
atgcacgtaaggctgagtttactgagtcccacccaacgtaccatactgccctttgcctcc
agctgttgcactaaggtttcaccacacgtttccagaaagcttctgaaagtggtgcgtgca
tgtcatctgcagagagctgatggcgactgtaacttggatgctgtcatccttcatgtccgg
cacagaagatactgtatcgctccagagaatcatactcttaaggagtggatgaaagcacaa
gcagtcaaggaaaatgacagacgcaaaatctgccataagaagaaatacatcaagaggaac
catgaaggggcacgtcggggaaagcatgtgacaggtggccataaaacttaccagacagtt
gatgcctaa

KEGG   Oryctolagus cuniculus (rabbit): 108176349
Entry
108176349         CDS       T03373                                 
Name
(RefSeq) uncharacterized LOC108176349
  KO
K16598  C-C motif chemokine 27
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    108176349
   04061 Viral protein interaction with cytokine and cytokine receptor
    108176349
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    108176349
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    108176349
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   108176349
SSDB
Other DBs
NCBI-GeneID: 108176349
NCBI-ProteinID: XP_017196196
UniProt: A0A5F9CL27
LinkDB
Position
1:19158512..19159459
AA seq 87 aa
MPGLRRYEVALEAEEEIYWGCFYFFPWLRMWRRERSSAHPREQKLEPLRGLMSCLSSGLG
PAPSRSGRGLHCRTPAAAAQAAGALKI
NT seq 264 nt   +upstreamnt  +downstreamnt
atgccgggattgaggagatacgaggtggcgctggaggcggaggaggagatctactggggc
tgtttctactttttcccctggctgcgaatgtggcggagagaacgaagttctgcacacccg
cgggagcagaagctggagcctctgcggggtctaatgagctgtctgtcgagcggcctgggc
cctgctccctcgcgttccggtcgtggcctccattgccgcactcccgccgccgctgcccag
gcagccggtgcattaaagatttaa

DBGET integrated database retrieval system