KEGG   Oryctolagus cuniculus (rabbit): 100303767
Entry
100303767         CDS       T03373                                 

Name
(RefSeq) C-C motif chemokine 28
  KO
K05513  C-C motif chemokine 28
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100303767
   04061 Viral protein interaction with cytokine and cytokine receptor
    100303767
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100303767
   04062 Chemokine signaling pathway
    100303767
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100303767
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   100303767
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100303767
NCBI-ProteinID: XP_002714062
Ensembl: ENSOCUG00000007934
LinkDB
Position
11
AA seq 126 aa
MQCAGLLLVALATCVALQPSEAILPFFSSCCTEVSPHLSRRLLKMVHTCHLQRADGDCDL
DAVALYFGRRRFCVTTENHMLKEWMKAQAAKKIGQRIICREKKYNKSSSRGTSVEGSMTG
CHKTSS
NT seq 381 nt   +upstreamnt  +downstreamnt
atgcagtgcgcaggactcttgctggtggccttggctacctgtgtggctcttcaaccctca
gaagccatattgccctttttctccagctgttgcactgaggtttcaccacacctttccaga
aggcttctgaagatggttcatacatgtcacctgcagagagctgatggggactgtgacttg
gatgctgtcgccctttatttcgggcgcagaagattctgtgttaccacagagaatcatatg
cttaaggaatggatgaaagcacaagcagccaagaaaattggtcaacgcataatttgccgc
gagaagaagtataataagagttcatcaaggggcacgtcagtggagggttccatgacgggc
tgccataagacttcttcctag

KEGG   Oryctolagus cuniculus (rabbit): 103349663
Entry
103349663         CDS       T03373                                 

Symbol
CCL28
Name
(RefSeq) C-C motif chemokine ligand 28
  KO
K05513  C-C motif chemokine 28
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103349663 (CCL28)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103349663 (CCL28)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103349663 (CCL28)
   04062 Chemokine signaling pathway
    103349663 (CCL28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103349663 (CCL28)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103349663 (CCL28)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103349663
NCBI-ProteinID: XP_008260555
LinkDB
Position
11
AA seq 122 aa
MHVRLSLLSPTQRTILPFASSCCTKVSPHVSRKLLKVVRACHLQRADGDCNLDAVILHVR
HRRYCIAPENHTLKEWMKAQAVKENDRRKICHKKKYIKRNHEGARRGKHVTGGHKTYQTV
DA
NT seq 369 nt   +upstreamnt  +downstreamnt
atgcacgtaaggctgagtttactgagtcccacccaacgtaccatactgccctttgcctcc
agctgttgcactaaggtttcaccacacgtttccagaaagcttctgaaagtggtgcgtgca
tgtcatctgcagagagctgatggcgactgtaacttggatgctgtcatccttcatgtccgg
cacagaagatactgtatcgctccagagaatcatactcttaaggagtggatgaaagcacaa
gcagtcaaggaaaatgacagacgcaaaatctgccataagaagaaatacatcaagaggaac
catgaaggggcacgtcggggaaagcatgtgacaggtggccataaaacttaccagacagtt
gatgcctaa

DBGET integrated database retrieval system