KEGG   Oryctolagus cuniculus (rabbit): 100328593
Entry
100328593         CDS       T03373                                 

Symbol
PIGR
Name
(RefSeq) polymeric immunoglobulin receptor
  KO
K13073  polymeric immunoglobulin receptor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    100328593 (PIGR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100328593 (PIGR)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   100328593 (PIGR)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Ig_2 Ig_4 Herpes_gE
Other DBs
NCBI-GeneID: 100328593
NCBI-ProteinID: NP_001164516
Ensembl: ENSOCUG00000014317
UniProt: P01832
LinkDB
Position
16
AA seq 773 aa
MALFLLTCLLAVFSAATAQSSLLGPSSIFGPGEVNVLEGDSVSITCYYPTTSVTRHSRKF
WCREEESGRCVTLASTGYTSQEYSGRGKLTDFPDKGEFVVTVDQLTQNDSGSYKCGVGVN
GRGLDFGVNVLVSQKPEPDDVVYKQYESYTVTITCPFTYATRQLKKSFYKVEDGELVLII
DSSSKEAKDPRYKGRITLQIQSTTAKEFTVTIKHLQLNDAGQYVCQSGSDPTAEEQNVDL
RLLTPGLLYGNLGGSVTFECALDSEDANAVASLRQVRGGNVVIDSQGTIDPAFEGRILFT
KAENGHFSVVIAGLRKEDTGNYLCGVQSNGQSGDGPTQLRQLFVNEEIDVSRSPPVLKGF
PGGSVTIRCPYNPKRSDSHLQLYLWEGSQTRHLLVDSGEGLVQKDYTGRLALFEEPGNGT
FSVVLNQLTAEDEGFYWCVSDDDESLTTSVKLQIVDGEPSPTIDKFTAVQGEPVEITCHF
PCKYFSSEKYWCKWNDHGCEDLPTKLSSSGDLVKCNNNLVLTLTLDSVSEDDEGWYWCGA
KDGHEFEEVAAVRVELTEPAKVAVEPAKVPVDPAKAAPAPAEEKAKARCPVPRRRQWYPL
SRKLRTSCPEPRLLAEEVAVQSAEDPASGSRASVDASSASGQSGSAKVLISTLVPLGLVL
AAGAMAVAIARARHRRNVDRVSIGSYRTDISMSDLENSREFGAIDNPSACPDARETALGG
KDELATATESTVEIEEPKKAKRSSKEEADLAYSAFLLQSNTIAAEHQDGPKEA
NT seq 2322 nt   +upstreamnt  +downstreamnt
atggctctcttcttgctcacctgcctgctggctgtcttttcagcggccacggcacaaagc
tccttattgggtcccagctccatatttggtcccggggaggtgaatgttttggaaggcgac
tcggtgtccatcacatgctactacccaacaacctccgtcacccggcacagccggaagttc
tggtgccgggaagaggagagcggccgctgcgtgacgcttgcctcgaccggctacacgtcc
caggaatactccgggagaggcaagctcaccgacttccctgataaaggggagtttgtggtg
actgttgaccaactcacccagaacgactcagggagctacaagtgtggcgtgggagtcaac
ggccgtggcctggacttcggtgtcaacgtgctggtcagccagaagccagagcctgatgac
gttgtttacaaacaatatgagagttatacagtaaccatcacctgccctttcacatatgcg
actaggcaactaaagaagtccttttacaaggtggaagacggggaacttgtactcatcatt
gattccagcagtaaggaggcaaaggaccccaggtataagggcagaataacgttgcagatc
caaagtaccacagcaaaagaattcacagtcaccatcaagcatttgcagctcaatgatgct
gggcagtatgtctgccagagtggaagcgaccccactgctgaagaacagaacgttgacctc
cgactgctaactcctggtctgctctatggaaacctggggggctcggtgacctttgaatgt
gccctggactctgaagacgcaaacgcggtagcatccttgcgccaggttaggggtggcaat
gtggtcattgacagccaggggacaatagatccagccttcgagggcaggatcctgttcacc
aaggctgagaacggccacttcagtgtagtgatcgcaggcctgaggaaggaagacacaggg
aactatctgtgcggagtccagtccaatggtcagtctggggatgggcccacccagcttcgg
caactcttcgtcaatgaagagatcgacgtgtcccgcagcccccctgtgttgaagggcttt
ccaggaggctccgtgaccatacgctgcccctacaacccgaagagaagcgacagccacctg
cagctgtatctctgggaagggagtcaaacccgccatctgctggtggacagcggcgagggg
ctggttcagaaagactacacaggcaggctggccctgttcgaagagcctggcaatggcacc
ttctcagtcgtcctcaaccagctcactgccgaggatgaaggcttctactggtgtgtcagc
gatgacgatgagtccctgacgacttcggtgaagctccagatcgttgacggagaaccaagc
cccacgatcgacaagttcactgctgtgcagggagagcctgttgagatcacctgccacttc
ccatgcaaatacttctcctccgagaagtactggtgcaagtggaatgaccatggctgcgag
gacctgcccactaagctcagctccagcggcgaccttgtgaaatgcaacaacaacctggtc
ctcaccctgaccttggactcggtcagcgaagatgacgagggctggtactggtgtggcgcg
aaagacgggcacgagtttgaagaggttgcggccgtcagggtggagctgacagagccagcc
aaggtagctgtcgagccagccaaggtacctgtcgacccagccaaggcagcccccgcgcct
gctgaggagaaggccaaggcgcggtgcccagtgcccaggagaaggcagtggtacccattg
tcaaggaagctgagaacaagttgtccagaacctcggctccttgcggaggaggtagcagtg
cagagtgcggaagacccagccagtgggagcagagcgtctgtggatgccagcagtgcttcg
ggacaaagcgggagtgccaaagtactgatctccaccctggtgcccttggggctggtgctg
gcagcgggggccatggccgtggccatagccagagcccggcacaggaggaacgtggaccga
gtttccatcggaagctacaggacagacattagcatgtcagacttggagaactccagggag
ttcggagccattgacaacccaagcgcctgccccgatgcccgggagacggccctcggagga
aaggatgagttagcgacggccaccgagagcaccgtggagattgaggagcccaagaaggca
aaacggtcatccaaggaagaagccgacctggcctactcagctttcctgctccaatccaac
accatagctgctgagcaccaagatggccccaaggaggcctag

DBGET integrated database retrieval system