KEGG   Oryctolagus cuniculus (rabbit): 100328662
Entry
100328662         CDS       T03373                                 
Symbol
SEMA6C
Name
(RefSeq) semaphorin 6C
  KO
K06842  semaphorin 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100328662 (SEMA6C)
SSDB
Motif
Pfam: Sema PSI
Other DBs
NCBI-GeneID: 100328662
NCBI-ProteinID: NP_001164766
Ensembl: ENSOCUG00000002736
UniProt: B7NZC6
LinkDB
Position
13:41059338..41067447
AA seq 961 aa
MPRAPHFMPLLLLLLLLSLPHTQAAFPQDPLPLLTSDLHGAPPLAWFRGLEDDAVAAELG
LDFQRFLTLNRTLLVAARDHVFSFDLQAQEEREGLVPSKYLTWRSQDVENCAVRGKLTDE
CYNYIRVLVPWDSQTLLACGTNSFSPVCRSYGITSLQQEGEELSGQARCPFDATQSNVAI
FAEGSLYSATAADFQASDAVVYRSLGSQPPLRSAKYDSKWLREPHFVHALEHGEHVYFFF
REVSVEDSRLGRVQFSRVARVCKRDMGGSPRALDRHWTSFLKLRLNCSVPGDSTFYFDVL
QALTGPVNLHGRSALFGVFTTQTNSIPGSAVCAFYLDDIERGFEGKFKEQRSLDGAWTPV
SEDRVPSPRPGSCAGVGGAALFPSSRDLPDDVLIFIKAHPLLDPAVPPATHQPLLTLTSR
ALLTQVAVDGMAGPHSNTTVLFLGSNDGTVLKVLPPGGRSGRAEPVLLEEIDAYSPSRCG
GKRAVQTARRIIGLELDTEGHRLFVAFSGCIVHFPLSRCARHGACRRSCLASQDPYCGWH
SSRGCVDVRGGGTDVDWVGSQESPEHGDCQDGATGSQSGLGDSAYVLLGPGPSPETPSPP
SDAHPRPQSSTLGAHTQGVCRDLPPALASRSVPIPLLLASVAAAFALGASVSGLLVSCAC
RRAHRRRSKDIETPGLPRPLSLRSLARLHGGGPEPPPPPKDGDAAPTPQLYTTFLPPADG
VPSPELACLPTPESTPELPAKHLRAAGGPWEWNQNGNNAKEGPGRARGGNAAGAPAQRVL
VRPPPPGCPGQAVEVTTLEELLRYLHGPQSPRKGAEPPAPAPFTSRPLPPEPAPTPALFA
DPSPLPRECAPPLRLDVPPEGKCAAPSARPALSAPAPRLGVGGSRRLPFSTHRTPPALLT
RVPSGGPARYSGGPGRHLLYLGRPEGYRGRGLKRADMEKSPKPPLGGPSHPAVPSGSHFN
F
NT seq 2886 nt   +upstreamnt  +downstreamnt
atgccccgtgccccccacttcatgcccttgctgctgctgctgctgctgctctcacttccc
cacacccaggccgcctttcctcaggacccgctccctttgttgacctctgacctgcatggt
gctcccccgttagcctggttccggggcctggaggatgatgctgtggctgcagaacttggg
ctggacttccagagattcctcaccttgaaccggaccttgctggtggctgcccgggatcac
gtcttctccttcgatctccaagcccaagaagaaagggagggcctggtgcccagcaagtat
ctgacatggcggagccaggatgtggagaactgtgccgtccggggaaagctgacggacgag
tgctacaactacatccgtgtccttgttccttgggactcgcagacgcttcttgcctgtggg
acgaactcattcagcccagtgtgccgcagctatgggataacttcgctgcagcaggagggt
gaggagctgagtgggcaggctcggtgcccgtttgatgccacccagtccaacgtggccatc
tttgcagagggcagcctgtactcagccacagccgcagatttccaggccagcgatgctgtt
gtttacagaagcctggggtctcagcccccactccgctccgccaagtacgactccaagtgg
ctccgagagccgcactttgtgcacgccttggagcacggagaacatgtctacttcttcttc
cgagaggtctctgtggaggactcccggctgggcagggtgcagttctctcgtgtagcccgc
gtctgtaaacgcgacatgggcggctcccctcgggccctggaccgccactggacctccttc
ctgaagctgcggctcaactgctccgtccctggggactccaccttctactttgatgtccta
caggccttgactgggcctgtgaacttgcatggccgctctgctctctttggggtcttcacc
acccagaccaatagcatccctggctctgcggtctgcgccttctacctggatgatattgag
cgtgggtttgagggcaagttcaaggagcagaggagtctggatggggcctggacccctgtg
tctgaggacagggtaccctcacccaggccgggctcctgtgcaggagtaggtggagcggcc
ttgttcccctcctctcgagacctccctgatgatgtcctgatcttcatcaaggctcaccca
cttctggaccccgctgtgccacctgccacccatcagcctctcctcactctcaccagcagg
gccctcctgacccaggtagctgtggacggcatggctggtccccacagtaacaccactgtc
ctgttcctcggctccaacgacgggacagtgctgaaggtgctgcccccaggggggcgctcc
gggcgagctgagcctgtcttactggaagagattgacgcctacagcccctcccggtgcggt
ggcaagcgggccgtccaaacagcacgacgcatcatagggctggagctggacacggagggt
cacaggctctttgtggccttttctggctgtatcgtccacttcccactcagccgctgcgcc
cggcacggggcctgtcgcaggagctgtctggcttctcaggacccctactgtggatggcat
agctccagaggctgcgtggatgtcagaggtggtgggaccgatgtggactgggttgggagc
caggaatccccggagcatggtgactgccaagatggggccaccgggagtcagtctggcctg
ggggattctgcttatgtgcttctgggtcctggcccttcccctgagacccccagtcccccc
agtgatgcccacccccggccccagtcttccactcttggagctcacactcagggcgtgtgc
cgggacctccccccagccttggcctcccgctcggtccccatcccactcctcctggccagt
gtggccgcggccttcgccttgggcgcctcggtctctggcctcctggtctcctgtgcttgt
cgccgcgcccaccgacgtcgtagcaaagacatcgagacccccgggctcccgcgccctctc
tcccttcgcagcctggcccggctgcacggcgggggcccagagccgccgccgccgcccaag
gacggagacgccgcgcctacgccgcagctctacaccaccttcctgcctcctgccgacggc
gtgccctcgccggagctggcctgcctgcccaccccagagtccacgcccgagctgcccgcc
aagcacctccgcgctgccgggggtccctgggagtggaaccagaacgggaacaacgccaag
gagggcccgggccgcgcgcggggcgggaacgcggcgggcgcccccgcgcagcgcgtgctg
gtgaggccgccgccgcccggctgccccgggcaggcggtggaggtcaccaccctggaggaa
ctgctgcgctacctgcacggcccgcagtcgcccaggaagggggccgagccgccagcccca
gccccttttacctcgcggccgctcccgccggagcctgcgcccaccccggcgctatttgca
gaccccagccccttaccccgggagtgtgccccgcctctgaggctggacgtgccccccgaa
ggcaagtgcgcggcccccagcgcccgacccgcgctctccgcccccgctccccgcctgggg
gttgggggcagccggaggttgcccttctccacccaccgtacgccacctgccctgctcact
cgggtgccctcgggagggcccgccaggtactctgggggtcccgggaggcacctcctgtac
ctgggccggcccgaggggtaccgaggccgcggcctgaagagggcggacatggagaagtcc
ccgaagcctcccctcggcgggccctctcacccggccgtccctagtggcagccattttaac
ttttaa

KEGG   Oryctolagus cuniculus (rabbit): 100353114
Entry
100353114         CDS       T03373                                 
Symbol
SEMA6D
Name
(RefSeq) semaphorin 6D
  KO
K06842  semaphorin 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100353114 (SEMA6D)
SSDB
Motif
Pfam: Sema PSI
Other DBs
NCBI-GeneID: 100353114
NCBI-ProteinID: XP_002717919
Ensembl: ENSOCUG00000007901
LinkDB
Position
17:complement(24798373..24854528)
AA seq 1073 aa
MRFFLLCAYVLLLMVSPLRAVSFPEDDEPLNTVDYHYSRQYPVFRGRPSGNESQHRLDFQ
LMLKIRDTLYIAGRDQVYTVNLNEIPQTEVIPSKKLTWRSRQQDRENCAMKGKHKDECHN
FIKVFVPRNDEMVFVCGTNAFNPMCRYYRLNTLEYDGEEISGLARCPFDARQTNVALFAD
GKLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGNYVYFFFREI
AVEHNNLGKAVYSRVARICKNDMGGSQRVLEKHWTSFLKARLNCSVPGDSFFYFDVLQSI
TDIIQINGIPTVVGVFTTQLNSIPGSAVCAFSMDDIEKVFKGRFKEQKTPDSVWTAVPED
KVPKPRPGCCAKHGLAEAYRTSIDFPDETLAFIKSHPLMDSAVPPIADEPWFTKTRVRYR
LTAIAIDRSAGPYQNYTVIFVGSEAGVVLKVLAKTSPFSLNDSVLLEEIEAYNHAKCNAE
NEEDKKVISLQLDKDHHALYVAFSSCVIRIPLSRCERYGSCKKSCIASRDPYCGWLSQGT
CGRVTPGMLAGGYEQDAEYGNTAHLGDCHEILPTSTTPDYKIFGGPTSDMEVFSSSVTTM
ASIPEITPKVSDTWRPKLTSSRKFVVQDDPNTSDFTDPLSGIPKGVRWEVQSGESNQMVH
MNVLITCVFAAFVLGAFIAGVAVYCYRDMFVRKNRKIHKDAESAQSCTDSSGSFAKLNGL
FDSPVKEYQQNIDSPKLYSNLLTSRKELPPSGDTKSMVMDHRGQPPELAALPTPESTPVL
HQKTLQAMKSHSDKAHSHGASRKETPQFFPSSPPPHSPLSHGHIPSAIVLPNATHDYNTS
FSNSNAHKAEKKLQHVDHPLTKSSSKRDHRRSVDSRNTLNDLLKHLNDPNSNPKAIMGDI
QMAHQTLMLDPVGPMSEVPPKVPNREASLYSPPSTLPRNSPTKRVDVPTTPGVPMTSLER
QRGYHKNSSQRHSISAMPKNLTSPNGVLLSRQPSVNRGGYMATPTGAKVDYIQGTPVSVH
LQPSLSRQSSYTSTGTLPRTGLKRTPSLKPDVPPKPAFVPQTTPVRPLNKYTY
NT seq 3222 nt   +upstreamnt  +downstreamnt
atgaggttcttcttactttgtgcctacgtgttgctcctaatggtgtccccactgagggca
gtcagctttcctgaagatgacgaaccccttaatactgttgattatcactattcaaggcaa
tatccggtttttagaggacgcccttcaggcaatgaatctcagcacaggctggactttcag
ctgatgttgaaaattcgagacacactttatattgctggcagggatcaagtttatacagta
aacttaaatgaaatcccccaaacagaagtaataccaagcaagaagctgacatggcggtca
agacaacaggatcgagaaaactgtgctatgaaaggcaaacataaagatgagtgccacaac
tttatcaaagtatttgttccaagaaatgatgagatggtttttgtttgtggtaccaatgca
ttcaatcccatgtgtcgatactataggttgaataccttagagtatgatggagaagaaatt
agtggcctggcaagatgcccatttgatgccagacaaaccaatgttgccctttttgcagat
gggaagctatattctgccacagtggctgacttcttggccagtgacgctgttatttatcgg
agcatgggagatggatctgccctccgcacaataaaatacgattccaagtggataaaagag
ccacactttcttcatgctatagaatatggaaactatgtctatttcttctttcgagaaatt
gctgtggaacacaataatttaggcaaggccgtctattcccgtgtggcccgcatatgtaaa
aatgacatgggtggctcccagcgggtcctggagaaacactggacatcttttctgaaggct
cggcttaactgttctgtccctggggattcgtttttctactttgatgttctgcagtccatt
acggacattatacaaatcaatggcatccctactgtggtcggggtgttcaccacacagctc
aacagcattcctggttctgcagtctgtgcatttagcatggatgacatagaaaaagtattc
aaaggacggtttaaagaacagaaaactccagattctgtttggacggcagtccctgaagac
aaagtaccaaagccaaggcctggctgttgtgcaaagcatggccttgctgaagcctacaga
acctccatcgactttccggatgagacgctggcgttcatcaaatcccaccctctgatggac
tcagctgttccacccattgctgatgagccctggttcacgaagacacgggtcaggtaccga
ttgacggccatcgccattgaccgctctgctggcccctaccagaactatacagtcatcttt
gttggctctgaagctggcgtggtactgaaagttttggcaaagaccagtcccttctctctg
aatgacagcgtattactggaagagattgaagcttacaaccatgcaaagtgtaatgctgag
aatgaggaagacaaaaaggtcatctcgttgcagttggataaagatcaccatgccttgtac
gtggcattctccagctgtgttatccgcatccccctcagccgctgtgagcgttatggatca
tgcaaaaagtcttgtattgcatctcgtgacccctactgtggctggctgagccagggaacc
tgtgggagagtaactccagggatgctcgctggaggctatgaacaagatgcagagtacggc
aacacagcccatctaggggactgccatgaaattttgcctacttcaactacaccagattac
aaaatatttggcggtccaacatctgacatggaggtattttcatcttctgttaccacaatg
gcaagtatcccagaaattacacctaaagtgagtgatacctggagacctaaactgacgagc
tcccggaaatttgtagtccaagatgacccaaacacttctgattttactgatcctttatca
ggtatcccaaagggtgtgcgctgggaagtccagtctggagagtccaaccagatggtccac
atgaatgtcctcatcacttgtgtctttgccgcttttgttttgggtgcgtttattgcagga
gtggcagtatactgctaccgcgacatgttcgttcggaaaaacaggaagatccataaagat
gcagaatctgcccagtcatgcaccgactccagtggaagttttgccaaactgaatggtctt
tttgacagcccagtcaaggaatatcaacagaatattgattctcctaaactttatagtaac
ctgctaaccagccggaaagagctgccacccagtggagataccaaatccatggtgatggac
catcgcggccaacctcccgagttggctgctctgcccacacctgagtctacaccggtgctg
caccagaagaccttgcaggccatgaagagccactcagacaaggcccacagccatggagct
tcaaggaaagaaacgccccagttttttccttctagtcctccaccccactcgccgttaagt
cacgggcatattcccagtgccatcgttcttccgaatgcgacgcatgactacaacacgtct
ttctcaaactccaatgctcacaaagcagaaaaaaagcttcagcacgtggatcaccctctt
acaaagtcatccagtaagcgagatcaccggcgttctgtggactccagaaatactctcaat
gatctcctgaagcatctaaatgacccaaatagtaaccccaaagccatcatgggagacatc
caaatggcccaccagaccctaatgctggatcccgtgggacccatgtccgaggtcccacct
aaggtgcctaaccgggaggcgtcactctactcccctccttccaccctccccagaaacagc
cccaccaagcgagtggatgtccccaccactcctggagtcccaatgacttctctggaaaga
caaagaggttatcacaaaaactcctcccagaggcactctatatctgcaatgcctaaaaac
ttaacctcaccaaatggcgtcttgttatctagacagcctagtgtgaaccgtggagggtat
atggccacccccacaggggcgaaggtggactacattcaggggacaccagtgagcgttcat
ctgcagccctcgctctccagacagagcagctacaccagtactggcacccttcccaggacg
ggactaaagaggacaccgtccttaaaacctgatgtgccaccaaagcctgcctttgttcct
cagaccacacctgtcagaccactgaacaaatacacttactag

KEGG   Oryctolagus cuniculus (rabbit): 100355525
Entry
100355525         CDS       T03373                                 
Symbol
SEMA6A
Name
(RefSeq) semaphorin 6A
  KO
K06842  semaphorin 6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100355525 (SEMA6A)
SSDB
Motif
Pfam: Sema PSI DUF3481
Other DBs
NCBI-GeneID: 100355525
NCBI-ProteinID: XP_008253146
Ensembl: ENSOCUG00000013815
UniProt: A0A5F9CQ14
LinkDB
Position
3:complement(1182188..1285711)
AA seq 1038 aa
MRSEALLLCFTLLHLAGAGFPEDSEPISISHGNYTKQYPVFVGHKPGRNSTQRHRLDIQM
VMVLNRTLYIAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNF
IKVLLRKNNDTLFVCGTNAFNPSCRNYKIDTLEPFGDEFSGMARCPYDAKHANVALFADG
KLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDHGDYIYFFFREMA
VEYNSMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVT
DVIRIHGRDVVLATFSTPYNSIPGSAVCAYDMVDIANVFTGRFKEQKSPDSTWTPVPDER
VPKPRPGCCAGSSSLEKYATSSEFPDDTLNFIKTHPLMDEAVPSIIHRPWFLRTMVRYRL
TKIAVDTAAGPYQNHTVVFLGSEKGVILKFLARIGTGGFLNDSLFLEEMSVYNPEKCSYD
GVEDRRIMGMQLDQASSSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVKEGG
SCAHLSPSSRLTFEQDIERGNTDGLGDCHNSFVALNDISTPPPDHEMSYNTVHGRSGSPL
PSTTSDAAAREGHESRAGVPDWTELHHPPGSTDPLGPVSSHNHQDKKGVIRESYLKGHDQ
LVPVTLLAIAVILAFVMGAVFSGIVVYCVCDHRRKDAASGQRRDKELAHSRRASMSSVTK
LGGLFGDSQAKDPKPEAVLTPLMHNGKLATPSGTAKVLIKADQHHLDLTALPTPESTPTL
QHKRKPSRGSREWERSQNLINACTKDMAPLGSPVIPTDLPLRASPSHIPSVVVLPITAQQ
GYQHEYVEQPKMGEAVHMALEEQGATLEYKTIKEHLGGKSPGPPGSLADSLPPKVPQREA
SLGPPGASLSQNGLSKRLEMHHSSSYGLDYKRSYPTNSLTRSHQAATLKRNNTNSSNSSH
LSRNPSFGRGDNPPPAPQRVDSIQGQPGGTVARQPSLGAYSSLSRPGLKRTPSLKPDVPP
KPSLAPLAAPMKPSDACT
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgaggtcagaagccttgctgctctgtttcacactgctgcacttggcgggggccggcttc
ccagaggattctgagccaatcagtatttcgcatggcaactatacaaaacagtatccggtg
tttgtgggccacaagccaggacggaacagcacacagagacacagactggacatccagatg
gtcatggtcttgaacagaaccctctacattgccgccagggaccatatttatactgttgat
atagacacatcacacacagaagaaatttactgtagcaaaaaactgacatggaaatctaga
caggctgatgtagacacgtgcagaatgaaggggaaacacaaggacgagtgccacaacttt
atcaaagtcctgctccggaagaacaatgacacgctgtttgtgtgcggaacgaacgccttc
aacccctcctgcagaaactacaagatagataccttggaaccttttggggatgaatttagt
gggatggcccggtgcccgtacgacgcaaaacatgccaacgtcgccctgtttgcagatggg
aagctgtactcggccacagtgaccgacttcctggccatcgacgccgtcatctaccggagt
ctgggagacagccccaccctgcggaccgtgaagcacgactccaagtggctgaaagaaccg
tatttcgtgcaagcggtggaccacggagactacatctacttcttcttcagagagatggcc
gtggagtacaacagcatggggaaggtggtgttcccccgcgtggcgcaggtgtgcaagaat
gacatgggtggctcccagcgggtgctggagaagcagtggacgtccttcctcaaggcccgc
ctcaactgctccgtgcccggcgactcgcacttctacttcaacatcctgcaggccgtgacc
gacgtgatccgcatccacggccgtgacgtcgtcctggcaaccttctccacaccttacaac
agcatccccggctctgcggtctgtgcctatgacatggtggacatcgccaacgttttcacc
gggagattcaaggagcagaagtcccccgactccacctggacaccggttcctgatgagcga
gttcccaagcccaggccaggctgctgtgcaggctcctcctccctggagaaatacgccacg
tccagtgagttccctgacgacaccttgaacttcatcaagacccacccgctcatggacgag
gccgtgccctccatcatccacaggccctggttcctgagaacaatggtcagataccgcctg
accaagatcgcagtggacacggccgcgggcccctaccagaaccacactgtggttttcctg
ggatccgagaagggagtcatcttgaagttcttggccaggataggaaccggcggcttccta
aatgacagcctcttcctggaggagatgagcgtctacaaccctgagaagtgcagctatgat
ggcgtggaggaccggaggatcatgggtatgcagctggaccaggcaagcagctctctgtac
gttgccttctccacctgcgtgataaaggtgcccctcggccggtgcgagcgacacggcaag
tgcaaaaaaacctgcatcgcctccagagacccctactgtgggtgggtgaaagaaggaggc
tcctgtgcacatctgtcacccagcagcagactgactttcgagcaggacatagagcgtggc
aacaccgacggcctgggagactgtcacaattccttcgtggccctgaacgacatttcaact
cctccaccagatcatgaaatgtcttacaacacagtgcatgggcgctccggctcccccctg
cccagcaccacatccgacgcggcggctcgagagggccacgagtccagggcaggggtgccc
gactggaccgagctgcaccacccacccggcagcacggaccctttggggccagtgtcttcc
cataaccaccaagacaagaagggagtgatccgcgagagttacctcaaaggccacgaccag
ctggttcccgtgaccctcctggccatcgccgtcatcctggcgttcgtcatgggagccgtg
ttctcgggcatcgtcgtctactgcgtgtgcgaccaccggcgcaaggacgcggcctcgggg
cagcgcagggacaaggagctggcgcactcccgccgcgcctccatgagcagcgtcaccaag
ctcggcggcctcttcggggactcccaggccaaggacccgaagcccgaggccgtgctcacg
ccgctgatgcacaatggcaagctggccacgcccagcggcacggccaaggtgctcatcaag
gcggaccagcaccacctggacctcacggccctgcccaccccggagtccacgcccacgctg
cagcacaagaggaagccgagccggggcagccgggagtgggagcgcagccagaacctcatc
aacgcctgcaccaaggacatggcgccgctgggctcgcccgtgatccccacggacctgccg
ctgcgggcgtcgcccagccacatccccagcgtggtggtgctgcccatcacggcgcagcag
ggctaccagcacgagtacgtggagcagcccaagatgggcgaggcggtccacatggcgctg
gaggagcagggcgccacgctggagtacaagaccatcaaggagcacctgggcggcaagagc
cccggccccccggggagcctcgcggacagcctgcccccgaaggtcccccagcgcgaggcc
tcgctcggccccccgggggcgtccctgtcccagaacgggctgagcaagcggctggagatg
caccactcctcctcctacggcctcgactacaagaggagctaccccacgaactcgctcacg
cgcagccaccaggccgccaccctcaaaaggaacaatactaactcctccaactcctcccac
ctgtcccggaacccgagcttcggccggggggacaacccgccccccgccccgcagagggtg
gactccatccagggccagcccgggggcaccgtggccaggcagcccagcctcggcgcctac
agctcgctgagcaggccggggctgaagcgcacgccctcgctgaagcctgacgtgcccccc
aaaccctccctcgcccccctcgccgcacccatgaagcccagtgacgcgtgtacataa

DBGET integrated database retrieval system