KEGG   Oryctolagus cuniculus (rabbit): 100328967
Entry
100328967         CDS       T03373                                 

Symbol
RLA-A1
Name
(RefSeq) MHC RLA region class I 19-1
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100328967 (RLA-A1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100328967 (RLA-A1)
   04145 Phagosome
    100328967 (RLA-A1)
  09143 Cell growth and death
   04218 Cellular senescence
    100328967 (RLA-A1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100328967 (RLA-A1)
   04612 Antigen processing and presentation
    100328967 (RLA-A1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100328967 (RLA-A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100328967 (RLA-A1)
   05170 Human immunodeficiency virus 1 infection
    100328967 (RLA-A1)
   05168 Herpes simplex virus 1 infection
    100328967 (RLA-A1)
   05163 Human cytomegalovirus infection
    100328967 (RLA-A1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100328967 (RLA-A1)
   05169 Epstein-Barr virus infection
    100328967 (RLA-A1)
   05165 Human papillomavirus infection
    100328967 (RLA-A1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100328967 (RLA-A1)
   05330 Allograft rejection
    100328967 (RLA-A1)
   05332 Graft-versus-host disease
    100328967 (RLA-A1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100328967 (RLA-A1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100328967 (RLA-A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100328967 (RLA-A1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100328967 (RLA-A1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100328967 (RLA-A1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100328967 (RLA-A1)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Trp_oprn_chp Ig_2 Protocadherin Podoplanin
Other DBs
NCBI-GeneID: 100328967
NCBI-ProteinID: NP_001164741
Ensembl: ENSOCUG00000010972
UniProt: P01894
LinkDB
Position
12
AA seq 361 aa
MGSMAPRTLLLLLAGALTLKDTQAGSHSMRYFYTSVSRPGLGEPRFIIVGYVDDTQFVRF
DSDAASPRMEQRAPWMGQVEPEYWDQQTQIAKDTAQTFRVNLNTALRYYNQSAAGSHTFQ
TMFGCEVWADGRFFHGYRQYAYDGADYIALNEDLRSWTAADTAAQNTQRKWEAAGEAERH
RAYLERECVEWLRRYLEMGKETLQRADPPKAHVTHHPASDREATLRCWALGFYPAEISLT
WQRDGEDQTQDTELVETRPGGDGTFQKWAAVVVPSGEEQRYTCRVQHEGLPEPLTLTWEP
PAQPTALIVGIVAGVLGVLLILGAVVAVVRRKKHSSDGKGGRYTPAAGGHRDQGSDDSLM
P
NT seq 1086 nt   +upstreamnt  +downstreamnt
atggggtccatggcgcctcggaccctcctcctgctgctcgcgggggcactgaccttgaaa
gacacccaggcgggctcgcactccatgaggtatttctacacctccgtgtcccggcccggc
ctgggggagccgcgcttcatcatcgtgggctacgtggacgacacgcagttcgtgcgcttc
gacagcgacgccgcgagcccgaggatggagcagcgggcgccgtggatggggcaggtggag
ccggagtactgggaccagcagactcagatcgccaaggacaccgctcagaccttccgcgtg
aacctgaacaccgcgctgcgctactacaaccagagcgcggccgggtctcacactttccag
acgatgtttggctgcgaggtctgggcggatgggcgcttcttccacgggtaccggcagtac
gcctacgacggcgccgactacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacacggcggctcagaacacccagcgcaagtgggaggcggcgggtgaggctgagcgccac
agggcctacctggagagggagtgcgtggagtggctgcgcagatacctggagatggggaag
gagacgctgcagcgcgcagacccgcccaaagcccacgtgacccaccaccctgcctctgac
cgggaggccaccctgaggtgctgggccctgggcttctaccccgcggagatctcactgacc
tggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcctggg
ggcgacggaaccttccagaagtgggcggctgtggtggtgccttctggggaggagcagaga
tacacgtgccgtgtgcagcatgaggggctgcctgagcccctcaccctgacatgggagcct
cctgctcagcccaccgcgctcatagtgggaattgttgctggagttcttggagttcttctg
atcctgggagctgtggtcgctgttgtgaggaggaagaagcacagctcagatgggaaagga
gggagatacactccggctgcaggtggccacagggaccagggctctgatgattctctcatg
ccctga

KEGG   Oryctolagus cuniculus (rabbit): 100338822
Entry
100338822         CDS       T03373                                 

Name
(RefSeq) RLA class I histocompatibility antigen, alpha chain 11/11
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100338822
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100338822
   04145 Phagosome
    100338822
  09143 Cell growth and death
   04218 Cellular senescence
    100338822
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100338822
   04612 Antigen processing and presentation
    100338822
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100338822
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100338822
   05170 Human immunodeficiency virus 1 infection
    100338822
   05168 Herpes simplex virus 1 infection
    100338822
   05163 Human cytomegalovirus infection
    100338822
   05167 Kaposi sarcoma-associated herpesvirus infection
    100338822
   05169 Epstein-Barr virus infection
    100338822
   05165 Human papillomavirus infection
    100338822
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100338822
   05330 Allograft rejection
    100338822
   05332 Graft-versus-host disease
    100338822
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100338822
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100338822
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100338822
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100338822
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100338822
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100338822
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 100338822
NCBI-ProteinID: XP_002714352
LinkDB
Position
12
AA seq 406 aa
MMKSLAPRTLLLLLPGALVLTETREGSHSMLYFETAVSRPGLGEPRFISVGYLDDTQFVR
FDSDAENPREEPRAAWMRQVDPGYWDRNTQIYKDNAQTYRVDLNTLRGYYSQNAAGSHTI
QRMYGCEVGADGRFLRGYQQDAYDGADYIALNEDLRSWTAADTAAQITRRKWEAAGAAEQ
DRAYLGGTCVEWLRRYLEMGKETLQRADPPKAHVTHHPASDKEATLRCWALGFYPAEISL
TWQRDGEDQTQDTELVETRPGGDGTFQKWAAVVVPSGEEQRYMCRVQHEGLPEPLTLRWE
PPAQSTVLIVGIVAGVLILGAMVPVVMRWMRTRRRQSSDGRGGRYTPAAVKFWRVMLGGG
HRDPCHSEKPMETLPAHPTLPPQPRPLWTSQSPDLFTPGGGIALSL
NT seq 1221 nt   +upstreamnt  +downstreamnt
atgatgaagtccctggcgcctcggacactcctcctgctgctcccgggggccctggtgctg
accgagacccgggagggctcgcactccatgttatacttcgaaaccgccgtgtcccggccc
ggcctgggggagccgcgcttcatctccgtgggctacttggacgacacgcagttcgtgcgc
ttcgacagcgacgccgagaacccgagggaggagccgcgggcggcgtggatgcggcaggtg
gacccggggtactgggaccggaacacgcagatctacaaggacaacgctcagacctaccgc
gtggacctgaacaccctgcgcggctactacagccagaacgcggccgggtctcacaccatc
cagaggatgtatggctgcgaggtcggggcggacggacgcttcctccgcgggtaccagcag
gacgcctatgatggcgctgactacatcgccctgaatgaggacctgcgctcctggaccgcg
gcggacaccgcggctcagatcacccggcgcaagtgggaggcggcaggtgcggctgaacaa
gacagagcctacctggggggcacgtgcgtggagtggctgcgcagatacctggagatgggg
aaggagacactgcagcgcgcagacccgcccaaagcccacgtgacccaccaccccgcctct
gacaaggaggccaccctgaggtgctgggccctgggcttctaccctgcggagatctcactg
acctggcagcgggatggggaggaccagacccaggacacggagctggtggagaccaggcct
gggggcgacggaaccttccagaagtgggcggctgtggtggtgccttctggggaggagcag
agatacatgtgccgtgtgcagcacgaggggctgccggagcccctcaccctgagatgggag
cctcctgctcagtccaccgtgctcatagtgggaattgttgctggagttctgatcctggga
gctatggtccctgttgtgatgaggtggatgaggacaaggaggaggcagagctcagatggg
agaggagggagatacactccggctgctgttaagttctggcgtgtgatgctgggtgggggt
caccgcgacccttgccacagtgagaagcccatggagacgctgcccgcccaccccacgctc
ccccctcagccacgccccctgtggacctcacagagtcctgatttgttcaccccaggaggt
ggcattgccttaagtctctga

KEGG   Oryctolagus cuniculus (rabbit): 100339821
Entry
100339821         CDS       T03373                                 

Name
(RefSeq) RLA class I histocompatibility antigen, alpha chain 11/11
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100339821
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100339821
   04145 Phagosome
    100339821
  09143 Cell growth and death
   04218 Cellular senescence
    100339821
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100339821
   04612 Antigen processing and presentation
    100339821
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100339821
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100339821
   05170 Human immunodeficiency virus 1 infection
    100339821
   05168 Herpes simplex virus 1 infection
    100339821
   05163 Human cytomegalovirus infection
    100339821
   05167 Kaposi sarcoma-associated herpesvirus infection
    100339821
   05169 Epstein-Barr virus infection
    100339821
   05165 Human papillomavirus infection
    100339821
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100339821
   05330 Allograft rejection
    100339821
   05332 Graft-versus-host disease
    100339821
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100339821
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100339821
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100339821
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100339821
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100339821
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100339821
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 100339821
NCBI-ProteinID: XP_017200462
LinkDB
Position
12
AA seq 191 aa
MGEPRFISVGYVDDTQFVRFDSDAARPRMEPRARWIRQVDPGNWDRNRRNAEDTAQTHRV
NLNTLRDYYNQSAADPPKAHVTHHPASDREATLRCWALGFYPAEISLTWQRDGEDQTQDT
ELVETRPGGDGTFQKXVAVVVPSGEEQRYTCRVQHEGLPEPLTLRWEPPAQPTIPTAGIV
AGLVVLGAVVI
NT seq 576 nt   +upstreamnt  +downstreamnt
atgggggagccgcgcttcatctccgtgggctacgtggacgacacgcagttcgtgcgcttc
gacagcgacgccgcgagacctaggatggagccacgggcgcggtggatacgacaggtggac
ccggggaactgggaccggaacaggcggaacgccgaggacaccgcgcagactcaccgcgtg
aacctgaacaccctgcgcgactactacaaccagagcgcggccgacccgcccaaagcccat
gtgacccaccaccccgcctctgaccgcgaggccaccctgaggtgctgggccctgggcttc
taccccgcagagatctcactgacctggcagcgggatggggaggaccagacccaggacacg
gagctcgtggagaccaggcctgggggcgacggaaccttccagaagtgagtggctgtggtg
gtgccttctggggaggagcagagatacacgtgccgtgtgcagcacgaggggctgcctgag
cccctcaccctgagatgggagcctcctgctcagcccaccatccccacagcgggaattgtt
gctggattggtggtgcttggagctgtggtcatatga

KEGG   Oryctolagus cuniculus (rabbit): 100348995
Entry
100348995         CDS       T03373                                 

Name
(RefSeq) RLA class I histocompatibility antigen, alpha chain 11/11
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100348995
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100348995
   04145 Phagosome
    100348995
  09143 Cell growth and death
   04218 Cellular senescence
    100348995
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100348995
   04612 Antigen processing and presentation
    100348995
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100348995
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100348995
   05170 Human immunodeficiency virus 1 infection
    100348995
   05168 Herpes simplex virus 1 infection
    100348995
   05163 Human cytomegalovirus infection
    100348995
   05167 Kaposi sarcoma-associated herpesvirus infection
    100348995
   05169 Epstein-Barr virus infection
    100348995
   05165 Human papillomavirus infection
    100348995
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100348995
   05330 Allograft rejection
    100348995
   05332 Graft-versus-host disease
    100348995
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100348995
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100348995
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100348995
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100348995
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100348995
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100348995
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig MHC_I_3 Ig_2 DUF2613 Syndecan
Other DBs
NCBI-GeneID: 100348995
NCBI-ProteinID: XP_008260889
LinkDB
Position
12
AA seq 337 aa
MFSLMPRTLLLLLAGALTLTQTQAGSHSMRFLHTTVSRAGLGEPRFTAVGYVDDTQCGRF
DSDAASPRAEPREPWGRQVEPGFWDTQTQILKGEMLSYLEVLNSLRIYYNQSEAGSHTLQ
SMFGCEVGPDGRFLRGYSQYAYDGADYLALNEHLHSWTAVDTRPNIWKPEWDGEQCTSFL
EGECVEWLRGFLEMGKETLQRIPPKTHVAHHPISDREATLRCWALGFYPAEISLTWQRDG
EDQTQDMELMETRPGGDGSFQKWAAVVVPSGEEQRYTCRVQHEGLPEPLTLRWEPPAQPT
MLIVGVVAGLVLGAVVTAAVVAFVMRKRKRKSSGREG
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgttttccttgatgcctcggaccctcctcctgctactcgcaggggccttgaccctaacc
cagactcaggcgggctcgcactccatgagatttctccacaccaccgtgtcccgggctggc
ctgggggagccgcgcttcactgccgtgggctacgtggacgacacgcaatgcgggcgcttc
gacagcgacgccgcgagtcccagggccgagcctcgggagccgtgggggcggcaggtggag
cccgggttctgggacacgcaaacgcagatcttgaagggcgaaatgctaagttacctcgag
gtcctgaactccctgcgcatctactacaaccagagcgaggccgggtctcacacactccag
tctatgttcggctgcgaagtggggccggatgggcgcttcctccggggatacagtcagtac
gcatacgatggcgccgactaccttgccctaaatgagcacctgcactcctggaccgcggtg
gacaccaggcctaacatctggaagcccgagtgggatggggagcagtgcacgtccttcttg
gagggcgagtgcgtggagtggctccgtgggttcctggagatggggaaggagaccctgcag
cgcatccccccaaagacacatgtggcccaccaccccatctctgacagggaggccaccctg
aggtgctgggccctgggcttctaccctgcggagatctcactgacctggcagcgggatggg
gaggaccagacccaggacatggagctcatggagaccaggcctgggggtgacggaagcttc
cagaagtgggcggctgtggtggtgccttctggggaggagcagagatacacgtgccgtgtg
cagcacgaggggctgcccgagcccctcaccctgagatgggagcctcctgctcagcccacc
atgctcatagtgggagtagttgctggcctggtcctcggagctgtggtcacagcagctgtg
gttgcatttgtgatgaggaagaggaagaggaagagctcaggtagggaggggtga

KEGG   Oryctolagus cuniculus (rabbit): 100349085
Entry
100349085         CDS       T03373                                 

Symbol
RLA-A2
Name
(RefSeq) RLA class I histocompatibility antigen, alpha chain 11/11
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100349085 (RLA-A2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349085 (RLA-A2)
   04145 Phagosome
    100349085 (RLA-A2)
  09143 Cell growth and death
   04218 Cellular senescence
    100349085 (RLA-A2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100349085 (RLA-A2)
   04612 Antigen processing and presentation
    100349085 (RLA-A2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100349085 (RLA-A2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349085 (RLA-A2)
   05170 Human immunodeficiency virus 1 infection
    100349085 (RLA-A2)
   05168 Herpes simplex virus 1 infection
    100349085 (RLA-A2)
   05163 Human cytomegalovirus infection
    100349085 (RLA-A2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100349085 (RLA-A2)
   05169 Epstein-Barr virus infection
    100349085 (RLA-A2)
   05165 Human papillomavirus infection
    100349085 (RLA-A2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100349085 (RLA-A2)
   05330 Allograft rejection
    100349085 (RLA-A2)
   05332 Graft-versus-host disease
    100349085 (RLA-A2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100349085 (RLA-A2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100349085 (RLA-A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100349085 (RLA-A2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100349085 (RLA-A2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100349085 (RLA-A2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100349085 (RLA-A2)
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2
Other DBs
NCBI-GeneID: 100349085
NCBI-ProteinID: XP_008260766
UniProt: G1T0F7
LinkDB
Position
12
AA seq 325 aa
MAPGTLLLLLAGALTLTQTRAGLHSMSYFYTAVSRPGLGEPRFITVGYVDDTQFSRFDSD
AENPRVEPRAAWMRQVDPGYWDRETQISKDNAQTYRVNLNTVRGYYNQSAAGSHTFQTMF
GCEVWADGRFFRGYEQHAYDGADYLALNEDLRSWTAADAAAQITQRKWESAGVAEHRRAY
LEGECVEWLRRYLEMGKETLQRADPPKAHVTHHPASDREATLRCWALGFYPAEISLTWQR
DGEDQTQDTELVETRPGGDGTFQKWAAVVVPSGEEQRYTCRVQHEGLPEPLTLRWEPPAQ
PTALIVGIVAGVLGVLLILGTVSLL
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcgcctgggaccctcctcctgctgctcgcgggggccctgaccctgacccagacccgg
gcgggcttgcactccatgagttatttctacaccgccgtgtcccggcccggcctgggggag
ccgcgcttcatcaccgtgggctacgtggacgatacgcagttctcgcgcttcgacagcgac
gccgagaacccgagggtggagccgcgggcggcgtggatgcggcaggtggacccggggtac
tgggaccgagagactcagatctccaaggacaacgctcagacctaccgcgtgaacctgaac
accgtgcgcggctactacaaccagagcgcggccgggtcccacactttccagactatgttt
ggctgcgaggtctgggcggatgggcgcttcttccgcgggtatgaacagcacgcctatgac
ggcgccgactacctcgccctgaacgaggacctgcgctcctggaccgcggcggacgcggcg
gcgcagatcacccagcgcaagtgggagtcggcgggtgtggctgagcaccgcagggcctac
ctggaaggggagtgcgtggagtggctgcgcagatacctggagatggggaaggagacactg
cagcgcgcagacccgcccaaagcccacgtgacccaccaccccgcctctgaccgcgaggcc
accctgaggtgctgggccctgggcttctaccccgcggagatctcactgacctggcagcgg
gatggggaggaccagacccaggacacggagctcgtggagaccaggcctgggggcgacgga
accttccagaagtgggcggctgtggtggtgccttctggggaggagcagagatacacgtgc
cgtgtgcagcacgaggggctgcctgagcccctcaccctgagatgggagcctcctgctcag
cccactgcgctcatagtgggaattgttgctggagttcttggagttcttctgatcctggga
actgtgtcgctgttatga

KEGG   Oryctolagus cuniculus (rabbit): 100349247
Entry
100349247         CDS       T03373                                 

Name
(RefSeq) HLA class I histocompatibility antigen, B-7 alpha chain
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100349247
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349247
   04145 Phagosome
    100349247
  09143 Cell growth and death
   04218 Cellular senescence
    100349247
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100349247
   04612 Antigen processing and presentation
    100349247
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100349247
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349247
   05170 Human immunodeficiency virus 1 infection
    100349247
   05168 Herpes simplex virus 1 infection
    100349247
   05163 Human cytomegalovirus infection
    100349247
   05167 Kaposi sarcoma-associated herpesvirus infection
    100349247
   05169 Epstein-Barr virus infection
    100349247
   05165 Human papillomavirus infection
    100349247
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100349247
   05330 Allograft rejection
    100349247
   05332 Graft-versus-host disease
    100349247
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100349247
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100349247
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100349247
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100349247
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100349247
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100349247
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig Ig_2 DUF4813
Other DBs
NCBI-GeneID: 100349247
NCBI-ProteinID: XP_008260890
Ensembl: ENSOCUG00000008993
LinkDB
Position
12
AA seq 363 aa
MGTLGLRPLLLLSGALVLAETRAGSHSLQFFTTAVSRPGRGEARYITVGYVDDTPFARFD
SYAENPRVEPRAPWMRQVEPGYWDRNTRFVKRSAQNYRVMLDNLRGYYNQSEAGSHTYQS
MCGCHLGPDGRLLRGYEQFAYDGADYITLNEDLRSWTAAHTAAQITQRQWEACGQAELRR
SYLEGECVEWLRRYLEMGKETLQSPVPPETRVTHHPISDQEATLRCWALGFYPKEISLTW
QQDGEDQTQDTELVETRPGGDGTFQKWAAVVVPSGEEQRYTCRVQHEGLPEPLTLTWERS
SQPTALIVGTIAGLILGAVVTAAMLIAVIKRKKSSGGEGGSYTQAASSDSTQDSDGSLTA
STV
NT seq 1092 nt   +upstreamnt  +downstreamnt
atggggaccctggggctccggcccctcctgctgctctcgggggccctggtgctggcagag
acccgggcaggttcccactccctgcagttcttcaccaccgccgtgtcccggccgggccgc
ggggaagcccggtacatcaccgtgggctacgtggacgacacgccgttcgcgcgcttcgac
agctacgccgagaacccgagggtggagccgcgggcgccgtggatgcggcaggtggagccg
gggtactgggaccggaacacgcggttcgtcaagcgcagcgcacagaactaccgagttatg
ctcgacaacctgcgcggctactacaaccagagcgaggccgggtctcacacctaccagtct
atgtgcggctgccatctggggccagacgggcgcctcctccgcgggtacgaacagttcgcc
tacgacggcgccgactacatcaccctgaacgaggacctgcgctcctggaccgcagcccac
acggcggctcagatcacccagcgccagtgggaggcgtgcggtcaagctgagctccgcaga
agctacctggagggggagtgcgtggagtggctgcgcagatacctggagatggggaaggag
acgctgcagagcccagtccccccagaaacacgtgtgacccaccaccccatctctgaccaa
gaggccaccctgaggtgctgggccctgggcttctaccctaaggagatctcgctgacctgg
cagcaggatggggaggaccagacccaggacacggagctcgtggagaccaggcctgggggc
gacggaaccttccagaagtgggcggctgtggtggtgccttctggggaggagcagagatac
acgtgccgtgtgcagcacgaggggctgcccgagcccctcaccctgacatgggagcggtca
tcccagcccacagcactaatcgtgggaaccatcgctggcctcattcttggagctgtggtc
accgcagcaatgctcattgctgtgataaagaggaagaagagctcaggtggagaagggggg
agctacactcaggctgcaagcagcgacagtacccaggactctgatgggtctctcacagct
tctacagtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100349757
Entry
100349757         CDS       T03373                                 

Name
(RefSeq) RLA class I histocompatibility antigen, alpha chain 11/11
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100349757
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100349757
   04145 Phagosome
    100349757
  09143 Cell growth and death
   04218 Cellular senescence
    100349757
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100349757
   04612 Antigen processing and presentation
    100349757
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100349757
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100349757
   05170 Human immunodeficiency virus 1 infection
    100349757
   05168 Herpes simplex virus 1 infection
    100349757
   05163 Human cytomegalovirus infection
    100349757
   05167 Kaposi sarcoma-associated herpesvirus infection
    100349757
   05169 Epstein-Barr virus infection
    100349757
   05165 Human papillomavirus infection
    100349757
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100349757
   05330 Allograft rejection
    100349757
   05332 Graft-versus-host disease
    100349757
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100349757
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100349757
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100349757
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100349757
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100349757
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100349757
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2 Protocadherin MHC_I_3 Gram_pos_anchor
Other DBs
NCBI-GeneID: 100349757
NCBI-ProteinID: XP_008260895
Ensembl: ENSOCUG00000006557
LinkDB
Position
12
AA seq 360 aa
MAARAHRGPPTWAGPWALVFLLLSFLRDVGAGSHSLQYFYWAVTEPSPGVPAFAASGFVD
NQRFIHYASEERKAKPCVQWLREEPSYFEDETKIFTSRMKIFQLSLRNVQQYYNQTLRPS
SKPEQPHKLAGPHTLQFTYGCELQDDGGTTGHWQYGYDGDDYLTLDVDSRQYVAASPLAR
YTKQKWEAGQDHMQRDVMYLTKECALWLHRYLELRGANSTRTDPPKAHVTHHPASDKEAT
LRCWALGFYPAEISLTWQRDGEDQTQDTELVETRPGGDGTFQKWAAVVVPSGEEQRYTCR
VQHEGLPEPLTLRWEPPAQPTALIVGIVAGVLGVLLILGVVVAVVRRRKHSSGRGGEGGV
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggctgcgcgcgcgcacaggggtcctccaacctgggccgggccctgggcgctcgtcttc
ctgctgctgagcttcctgcgggacgtgggggccggatcgcactctctgcagtatttctac
tgggctgtgacagagccaagtccaggagtccctgcctttgctgcctctggcttcgtggat
aaccaacgcttcatccactacgccagtgaggagaggaaggctaagccttgcgtccagtgg
ctgagggaggagcccagttactttgaggatgagaccaagatcttcacaagtcgaatgaag
attttccagctaagcctgagaaacgtgcagcagtactacaaccaaaccctgaggccaagt
tcaaagccagagcagccacacaagctggcagggccccacactctgcagttcacatatggc
tgtgaactccaagacgacggtgggaccacgggacactggcagtacggctacgacggtgac
gactacctgaccttggatgtggactctcggcagtatgtggcagcctcacctctagcccgc
tacaccaagcagaaatgggaggccggccaggaccacatgcagagagacgtgatgtacttg
acaaaggagtgtgccctgtggctgcacagatacttggagctcagaggggcaaactccacg
cgcactgacccgcccaaagcccacgtgacccaccaccccgcctctgacaaggaggccacc
ctgaggtgctgggccctgggcttctaccccgcggagatctcactgacctggcagcgggat
ggggaggaccagacccaggacacggagctcgtggagaccaggcctgggggcgacggaacc
ttccagaagtgggcggctgtggtggtgccttctggggaggagcagagatacacgtgccgt
gtgcagcacgaggggctgcctgagcccctcaccctgagatgggagcctcctgctcagccc
actgcgctcatagtgggaattgttgctggagttcttggagttcttctgatcctgggagtt
gtggtcgctgttgtgaggaggaggaagcacagctcaggtaggggaggggagggtggggtc
tga

KEGG   Oryctolagus cuniculus (rabbit): 100354611
Entry
100354611         CDS       T03373                                 

Name
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100354611
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100354611
   04145 Phagosome
    100354611
  09143 Cell growth and death
   04218 Cellular senescence
    100354611
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100354611
   04612 Antigen processing and presentation
    100354611
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100354611
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100354611
   05170 Human immunodeficiency virus 1 infection
    100354611
   05168 Herpes simplex virus 1 infection
    100354611
   05163 Human cytomegalovirus infection
    100354611
   05167 Kaposi sarcoma-associated herpesvirus infection
    100354611
   05169 Epstein-Barr virus infection
    100354611
   05165 Human papillomavirus infection
    100354611
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100354611
   05330 Allograft rejection
    100354611
   05332 Graft-versus-host disease
    100354611
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100354611
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100354611
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100354611
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100354611
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100354611
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100354611
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_3 NAD4L
Other DBs
NCBI-GeneID: 100354611
NCBI-ProteinID: XP_002713938
Ensembl: ENSOCUG00000023680
UniProt: A0A5F9CKU7
LinkDB
Position
11
AA seq 359 aa
MAELASLKLENKPWPGGTHSLHYHYLALSEPGPSLPEFLAVGYVDDQPFIRYDSRTGRAE
LRAAWMAPVDTQYWETETQKQKAWEKVQQVEMWTVMGYHNQSSGTHTAQRMFGCEVQEDG
SSSSFWQFGFDGQDHLSLDVETLSWVSAEPVAVRTKRWWETERCYAEYDKAYLEGLCLTS
LHRYLELGSQSLTRKEPPMVHITKHMTQDGTTLRCWALGFYPQDISLNWWLDGEELTLET
EHVETRPSGDGTYQTWVAVQVPAGKEAWYSCHVRHPGLNHTLTVAWESPSNSGLIAMAIS
TVLITIMLIAVTVIWSKRCLQAWNKKSYVQTPGQDPESQCPVTAGTPQSSLLTEIPFTT
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcagaactggccagcctgaagttagaaaacaagccatggcctggagggacacattct
ctccactatcactacctggctctgtcagagccaggcccaagcctccctgagtttttggct
gtgggttatgtggatgaccagcccttcatccgatatgacagtcgtacgggcagggctgag
cttcgggccgcatggatggcacctgtggacacccagtactgggagacagagacccagaaa
cagaaggcatgggagaaagtacagcaggtggagatgtggacagtgatgggataccacaac
cagagcagtggcacacacactgctcaacgcatgtttggctgtgaagtccaggaggatggc
agctccagtagcttctggcagtttggcttcgatgggcaggatcacctgtcattggatgtg
gagacactgagctgggtatcagctgagccagtggccgtgaggacaaagcgctggtgggag
acagagcgttgctatgctgagtacgacaaagcctacctagaaggcctctgtctcacctcc
ctgcacaggtacctggagctgggaagccagagcctcaccaggaaagagcctcccatggtg
cacataacaaagcacatgacccaggatggaaccacactgaggtgctgggccctgggattc
tacccacaggacatctcattgaactggtggctggatggggaggagctgacgttggagact
gagcatgtggagacccgccccagtggagatggcacctaccagacatgggtggctgttcag
gtgccggctgggaaagaggcttggtacagctgccacgtgcggcatcctgggctgaaccat
acactcaccgtggcctgggaatcaccttcgaatagtgggctcattgccatggctatttcc
acagtcttgatcaccatcatgctgatagctgtaactgtaatatggtccaagaggtgcctt
caagcctggaataagaagtcctatgtgcaaaccccaggacaagaccctgaatctcagtgc
ccagtgacagcaggaactcctcagtcttctctgctgacagaaattccctttactacataa

KEGG   Oryctolagus cuniculus (rabbit): 100355380
Entry
100355380         CDS       T03373                                 

Name
(RefSeq) HLA class I histocompatibility antigen, A-36 alpha chain
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100355380
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100355380
   04145 Phagosome
    100355380
  09143 Cell growth and death
   04218 Cellular senescence
    100355380
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100355380
   04612 Antigen processing and presentation
    100355380
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100355380
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100355380
   05170 Human immunodeficiency virus 1 infection
    100355380
   05168 Herpes simplex virus 1 infection
    100355380
   05163 Human cytomegalovirus infection
    100355380
   05167 Kaposi sarcoma-associated herpesvirus infection
    100355380
   05169 Epstein-Barr virus infection
    100355380
   05165 Human papillomavirus infection
    100355380
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100355380
   05330 Allograft rejection
    100355380
   05332 Graft-versus-host disease
    100355380
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100355380
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100355380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100355380
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100355380
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100355380
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100355380
SSDB
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig DUF2613 Ig_2 EphA2_TM
Other DBs
NCBI-GeneID: 100355380
NCBI-ProteinID: XP_002714393
Ensembl: ENSOCUG00000010984
UniProt: A0A5F9CXA9
LinkDB
Position
12
AA seq 352 aa
MMGSMAPGTLLPLLAGALTLTETWAGSHSMRHFFTSVSRPGLGEPRFLAVGYVDDTQFAR
FDSDAAAAGMEPRAPWMRQVEPRYWDMHRQRFEWGTLSFREYLSNLRIYYNQSEEGSHTI
QGMYGCEVGPDGRFLRGYSILAYDGADYLVLNEHLHSWTAVDTRPNIWKPEWDGKQCTSY
LEGACVEWLRGFLEMGKETLQRVDPPKTHVAHHPISDKEATLRCWALGFYPKEISLTWQR
DGEDQTQDTELVETRPGGDGSFQKWAAVVVPSGEEQRYTCRVQHEGLPEPLTLRWEPPAQ
PTTLIVGVVAGLVLGAVVTAAVVAFVMRKRKSSDSKNSQDSHMSLTASTATA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgatgggatccatggcgcctgggaccctcctcccgctgctcgctggagccctgaccctg
accgagacctgggcgggctcgcactccatgaggcatttcttcacttcggtgtcccggcct
ggcctgggagagccgcgattcctcgccgtgggctacgtggatgacacgcagttcgcgcgc
ttcgacagcgacgccgcggctgcgggtatggagcctcgggcgccgtggatgcggcaggtg
gagcctaggtactgggacatgcacaggcagagattcgaatggggcacactgagtttccgg
gagtacctgagcaacctgcgcatctactacaaccagagcgaggaagggtctcacaccatc
caggggatgtatggctgcgaagtggggccagacgggcgcttcctccggggatacagtatc
ttagcctacgacggcgccgactacctcgtcctgaatgaacacctgcactcctggaccgcg
gtggacaccaggcctaacatctggaagcccgagtgggatgggaagcagtgcacgtcctac
ctggagggcgcgtgtgtggagtggctccgtgggttcctggagatggggaaggagaccctg
cagcgcgtagatccccccaagacacatgtggcccaccaccccatctctgacaaggaggcc
accctgaggtgctgggccctgggcttctaccctaaggagatctcgctgacctggcagcgg
gatggagaggaccagacccaggacacggagctcgtggagaccaggcctgggggcgacgga
agcttccagaagtgggcggctgtggtggtgccttctggggaggagcagagatacacgtgc
cgtgtgcagcacgaggggctgcccgagcccctcaccctgagatgggagcctcctgctcag
cccaccacgctcatagtgggagtagttgctggcctggtcctcggagctgtggtcacagca
gctgtggttgcatttgtgatgaggaagaggaagagctcagacagcaagaattcccaggat
tctcatatgtctctcacggcttctacagccacagcatga

KEGG   Oryctolagus cuniculus (rabbit): 100356371
Entry
100356371         CDS       T03373                                 

Symbol
RLA-A3
Name
(RefSeq) MHC class I antigen-like
  KO
K06751  MHC class I antigen
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04145  Phagosome
ocu04218  Cellular senescence
ocu04514  Cell adhesion molecules
ocu04612  Antigen processing and presentation
ocu04940  Type I diabetes mellitus
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05203  Viral carcinogenesis
ocu05320  Autoimmune thyroid disease
ocu05330  Allograft rejection
ocu05332  Graft-versus-host disease
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100356371 (RLA-A3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100356371 (RLA-A3)
   04145 Phagosome
    100356371 (RLA-A3)
  09143 Cell growth and death
   04218 Cellular senescence
    100356371 (RLA-A3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100356371 (RLA-A3)
   04612 Antigen processing and presentation
    100356371 (RLA-A3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100356371 (RLA-A3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100356371 (RLA-A3)
   05170 Human immunodeficiency virus 1 infection
    100356371 (RLA-A3)
   05168 Herpes simplex virus 1 infection
    100356371 (RLA-A3)
   05163 Human cytomegalovirus infection
    100356371 (RLA-A3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100356371 (RLA-A3)
   05169 Epstein-Barr virus infection
    100356371 (RLA-A3)
   05165 Human papillomavirus infection
    100356371 (RLA-A3)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100356371 (RLA-A3)
   05330 Allograft rejection
    100356371 (RLA-A3)
   05332 Graft-versus-host disease
    100356371 (RLA-A3)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100356371 (RLA-A3)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100356371 (RLA-A3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100356371 (RLA-A3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
    100356371 (RLA-A3)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100356371 (RLA-A3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ocu00537]
 Antigens
  100356371 (RLA-A3)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 Trp_oprn_chp ig Ig_2 DUF357 Protocadherin Podoplanin
Other DBs
NCBI-GeneID: 100356371
NCBI-ProteinID: NP_001177363
UniProt: Q30849
LinkDB
Position
12
AA seq 358 aa
MECGALLLLLAGALTLTETRTGSHSLRYFTTAVSRPGLPEPRFMSVGYVDDTQFVRFDSD
AASPRAEPRAPWMRQVDPGYWDRQTERAKNTALSFRVNLQTLRGYYNQSDTGSHTLQWMY
GCEVGADGRLLRGYEQFAYDGADYIALNEDLRSWTAADTTAQISKRKSEEASEAEHHRSY
LEGECVEWLRRYLEDGKETLQRADPPKAHVTHHPASDKEATLRCWALGFYPAEISLTWQR
DGEDQTQDTELVETRPGGDGTFQKWAAVVVPSGEEQRYTCRVQHKGLPEPLTLRWEPPAQ
PTALIVGIVAGVLGVLLILGAVVAVVMRRKHSSDGKGGKYAPAAGGHRDQGSDDSLMP
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggagtgcggggccctcctcctgctgctcgcgggggccctaacactgaccgagacccgg
acaggctcgcactccctgcggtatttcaccaccgcagtgtcccggcccggcctgccggag
ccgcgcttcatgtccgtgggctacgtggacgacacgcagttcgtgcgcttcgacagcgac
gccgcgagcccgagggccgagccgcgggcgccgtggatgcggcaggtggacccggggtac
tgggaccggcagaccgagcgcgccaagaacaccgcgctttctttccgagtaaacctgcag
accctgcgcggctactacaaccagagcgacaccgggtctcacaccctccagtggatgtac
ggctgcgaggtcggggcggacgggcgcctcctccgcgggtacgagcagttcgcctacgac
ggcgccgactacatcgccctgaacgaggacctgcgctcctggaccgcggcggacacgaca
gcgcagatctccaagcgcaaatcggaggaagccagcgaggcggagcaccacaggtcctac
ctggagggggagtgcgtggagtggctgcgcagatacctggaggacgggaaggagacgctg
cagcgcgcagacccgcccaaagcccacgtgacccaccaccccgcctctgacaaggaggcc
accctgaggtgctgggccctgggcttctaccccgcggagatctcactgacctggcagcgg
gatggggaggaccagacccaggacacggagctcgtggagaccaggcctgggggcgacgga
accttccagaagtgggcggctgtggtggtgccttctggggaggagcagagatacacgtgc
cgtgtgcagcacaaggggctgcctgagcccctcaccctgagatgggagcctcctgctcag
cccactgcgctcatagtgggaattgttgctggagttcttggagttcttctgatcctggga
gctgtggtcgctgttgtgatgaggaggaagcacagctcagatgggaaaggagggaaatac
gctccggctgcaggtggccacagggaccagggctctgatgattctctcatgccctga

DBGET integrated database retrieval system