KEGG   Oryctolagus cuniculus (rabbit): 100337728
Entry
100337728         CDS       T03373                                 

Name
(RefSeq) NKG2-A/NKG2-B type II integral membrane protein
  KO
K06541  killer cell lectin-like receptor subfamily C1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04612  Antigen processing and presentation
ocu04650  Natural killer cell mediated cytotoxicity
ocu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100337728
   04612 Antigen processing and presentation
    100337728
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    100337728
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    100337728
   04091 Lectins [BR:ocu04091]
    100337728
CD molecules [BR:ocu04090]
 Proteins
  100337728
Lectins [BR:ocu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   100337728
SSDB
Motif
Pfam: Lectin_C Chordopox_A33R UL45 DUF2970 Claudin_2
Other DBs
NCBI-GeneID: 100337728
NCBI-ProteinID: XP_008257864
Ensembl: ENSOCUG00000025311
UniProt: G1TNB6
LinkDB
Position
8
AA seq 235 aa
MNNQRVVYSELNLTKGPKKQQRRPKGTKISISDTEEEITYVELNLQNVSQERQGNDKNGH
CKDSTLPPEKIISGILGVICFVLMVTVVVTMTIAIPSTAIQEQNNSSHIRRTQKALHCHH
CPKEWLIYSNSCYYTSMEKKTWNDSVMACASKNSNLLYIDHEEEVKFLSSHSFLSWIGVF
RKHSHDSWISVNGSTFKLKIKELSYGEHNCAMLSLSGLQSDSCKSLKTYNCKHKL
NT seq 708 nt   +upstreamnt  +downstreamnt
atgaataaccaaagagtagtctactcggagttgaatctgaccaagggcccaaagaagcag
caaaggagaccaaagggcactaaaatctccatttcagacactgaagaggaaataacctat
gtggaattaaaccttcaaaacgtttctcaagaacgtcaagggaatgacaagaatggccat
tgcaaagattcaactctccctccagagaagatcatttctgggatcctgggagtcatctgc
tttgtcttaatggtcactgtggtggtaacaatgacaattgctattccctctactgcaata
caggaacagaacaattcttctcatataagaagaacccagaaagcattgcattgtcatcat
tgtccaaaggagtggttaatatattccaacagttgttattatactagcatggaaaaaaaa
acttggaatgacagtgtgatggcctgtgcttctaagaactcaaatctgctctatatagat
catgaggaagaagtgaaatttctaagttcccactcatttctatcatggattggagtcttt
cgtaagcactctcatgattcatggatatcagtaaatggctcaactttcaaactaaaaata
aaagaactgtcatatggtgaacataactgtgctatgttatccttatctggccttcaatca
gacagttgcaaatctttaaaaacatataactgtaagcataagctctag

KEGG   Oryctolagus cuniculus (rabbit): 103348990
Entry
103348990         CDS       T03373                                 

Name
(RefSeq) natural killer cells antigen CD94
  KO
K06516  killer cell lectin-like receptor subfamily D member 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04612  Antigen processing and presentation
ocu04650  Natural killer cell mediated cytotoxicity
ocu05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    103348990
   04612 Antigen processing and presentation
    103348990
 09160 Human Diseases
  09163 Immune disease
   05332 Graft-versus-host disease
    103348990
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ocu04090]
    103348990
   04091 Lectins [BR:ocu04091]
    103348990
CD molecules [BR:ocu04090]
 Proteins
  103348990
Lectins [BR:ocu04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   103348990
SSDB
Motif
Pfam: Lectin_C DUF4064 Chordopox_A33R Ly49
Other DBs
NCBI-GeneID: 103348990
NCBI-ProteinID: XP_017198866
Ensembl: ENSOCUG00000029274
LinkDB
Position
8
AA seq 176 aa
MAVSHTTLWRFISGILGVICVLLMATLGIVLKNSFAKQSNQTTFSSEPMMELQEGPDCCS
CPDGWIGYQCNCYFISNEARTWEDSRHFCAVQNSSLLKLQNRDELSFWNHSQHFYWIGLS
YREEHGAWLWEDDSAVSQHLFPMFQGLTPKSCILYSPRKNVLSEDCKSSCYYICKK
NT seq 531 nt   +upstreamnt  +downstreamnt
atggcagtttctcacacgactctgtggaggttcatttctgggatcttgggagtaatatgt
gttttgctgatggctactttgggaattgtgttgaaaaactcatttgctaagcagagtaat
cagacaaccttctcttcagagcccatgatggaactccaggaaggccctgactgctgttct
tgtccagacgggtggattgggtatcagtgcaactgttacttcatttctaatgaagcgaga
acttgggaagacagtaggcatttctgtgctgttcagaattccagtctacttaagctccaa
aacagagatgaactgagtttttggaaccacagtcaacacttttactggattggactctcc
tatagggaggaacatggtgcctggttgtgggaggatgactctgctgtctcccagcatcta
tttccaatgtttcaaggtttaactccaaagagctgcatcctgtatagcccaagaaaaaat
gttttgagtgaagactgtaaaagtagttgttattatatctgtaagaaatag

DBGET integrated database retrieval system