KEGG   Oryctolagus cuniculus (rabbit): 100337757
Entry
100337757         CDS       T03373                                 
Symbol
PIK3R5
Name
(RefSeq) phosphoinositide-3-kinase regulatory subunit 5
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04371  Apelin signaling pathway
ocu04611  Platelet activation
ocu04725  Cholinergic synapse
ocu04921  Oxytocin signaling pathway
ocu05145  Toxoplasmosis
ocu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100337757 (PIK3R5)
   04072 Phospholipase D signaling pathway
    100337757 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    100337757 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    100337757 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100337757 (PIK3R5)
   04062 Chemokine signaling pathway
    100337757 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100337757 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100337757 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    100337757 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100337757 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100337757 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100337757 (PIK3R5)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100337757 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101 BUD22 Sporozoite_P67 ApoC-I DUF2284
Other DBs
NCBI-GeneID: 100337757
NCBI-ProteinID: XP_002719015
Ensembl: ENSOCUG00000022712
UniProt: G1TZJ0
LinkDB
Position
19:10407684..10480320
AA seq 880 aa
MQPGATTCTEDRIQHALDRCLHGLSLGRRSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAARTYHRFLTWPIPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPVRSRRSSTVTVLLLNPVEVQAEFLAVAN
KLSAPGHSPHSTYTTLLLHAFQATFGAHCDLPGLHCSLQSKTLAELEDIFTETAEAQELA
SGIGDAAEARQWLRTKLQAVGEKAGFPAVLDTPRAGKLHTIPLPVARCYTYSWNQDSFDI
LQEILLKEQELLQPGILGDDEEEEEEDEEEEEDEEDSDGHSAERDSLLSTGSLASRDSTL
SLASCQASGPALSQHLLTSFVAGLSDGMDSGYVEDSEESASEWPKRPGRQERRGHRRPGQ
KFNRIYKLFKSTSQLVLRKDSRGLEGSPDSALPLRRAGSLCSPLDSPASPPSRAQRSRSL
PQPRLGTQLPSWLLTPATRPQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLR
TLESSRPLLTRFFKLQFFYVPVKRTGTGSSTCLAPRSQTPPLPTDSPRHPSPVELGSAPW
EESTNDISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAETRPLEGSPAPLPILADMLL
YYCRFAARPVLLQVYQTELTFITGEKTTEIFIQSLELGHSAATRAIKASGPGSKRLGIDD
DREAIPLTLQIIYSKGAISGRSRWSNLEKVCTSVNLNKACRQQEELDSSMEALTLHLTEV
VKRQNPKSKKSFNQISTSQIKVDKVQIIGSSSCPFAVCLDQDERKILQSVVRCEVSPCYK
PEKSSLSPPAQTPPDLPARAAPDLCSLLCLPIMTFSGALP
NT seq 2643 nt   +upstreamnt  +downstreamnt
atgcagccgggggccacgacgtgcacggaggaccgtatccagcacgccctggaccgctgc
ttgcatggactcagcctcggccgccgctccacctcctggtcagctgggctgtgtctgaat
tgttggagcctccaggagctggtgagcagggaccccggccacttccttatcctgctggag
cagatcctgcagaaaacccgagaggtccaagagaagggcacctatgacctcctggcacca
ctggccctgctgttctactccaccgtcctctgtacaccacacttcccaccagactcggac
ctcctcctgaaggcagccagaacctaccaccggttcctgacctggcccattccctactgc
agcatctgccaggagctgctcaccttcatcgacgctgaactcaaggccccaggaatctcc
taccagcgactggtgagagctgagcagggtctgcccgtcaggagccgccgcagttccacc
gttactgtgctgctgctgaaccccgtggaggtgcaggccgagttcctcgccgtagccaac
aagctaagtgcacccgggcactcgccccacagcacctacactaccctgctcctgcatgcc
ttccaggccaccttcggggcccactgcgacctcccgggcctgcactgcagcctgcagtcc
aagaccttagccgagcttgaagacatcttcacggagaccgcagaggcgcaggagctggca
tctggcatcggggacgcagctgaggcgcggcaatggctcaggaccaagctgcaggcggtg
ggagaaaaagccggcttccctgccgtcttggacactcccagagccggcaagctccacacc
atcccactccctgtcgccaggtgctacacctacagctggaaccaggacagctttgacatc
ctgcaggaaatcctgcttaaggagcaggagctgctccaaccagggatcctgggggacgat
gaagaggaagaagaggaagacgaggaggaggaggaagacgaggaggactcggacgggcat
tctgccgagagggactctctgctgtccactggctctttggcctcccgcgactccaccctg
tcccttgcctcctgccaggcctcagggccagccctctcccagcacctgctgacttccttc
gtggccggcctctcggacggcatggacagcggctacgtggaagacagtgaggagagcgcc
tctgagtggcccaagaggcccggccgccaggagcgccggggccaccgcaggcccgggcag
aagtttaacagaatctacaaactcttcaagagcactagccagctggtgttgcggaaggac
tcccggggcctggagggcagcccggattcggccctgcccctgcggcgggcagggagcctc
tgcagccccctggacagcccagcctcacccccgtcccgggcccagcgctcccgctccctg
ccccagcccaggctcggcacccagctccccagctggctgctcacccccgccacacgcccc
cagcgccgccgccccttcctgagtggggatgaggaccccaaagcttccacgctccgtgtc
gtggtcttcggctctgatcggatttcagggaaggtggctcgggcttacagcaacctccgg
acgctggagagcagccgcccactcctcacgcgcttcttcaagctccagttcttctacgtg
cctgtgaagcgaaccggaaccggctccagcacctgtctggcccctcgaagccagacgccc
ccactccccacagactccccgaggcaccccagccctgtagagctgggctcggccccgtgg
gaggagagcaccaatgacatctcccactacctcggcatgctcgacccctggtatgagcgc
aacgtgctaggcctcatgcacctgcccccggaagtcctatgccagcagtccctgaaggct
gaaacccggcccctggagggctccccagccccgctgcccatcctggctgatatgctgctc
tactactgccgctttgccgcccggccggtgctgctgcaggtctatcagacagagctgacc
ttcattacgggggagaagaccacggagatctttatccagtccctggagctaggtcactct
gctgccacgcgggccatcaaggcttctggccccggaagcaagcggctgggcattgatgac
gaccgggaggccatccctctaacactacagattatttacagcaagggcgccatcagtggg
cgaagtcgctggagcaacctggagaaggtctgtacctctgtcaacctcaacaaggcttgc
cggcagcaggaggagctggactccagcatggaggccctgacgctacacctgacggaagtg
gtgaaaaggcagaaccccaaatccaagaagagctttaatcagattagcacatcccagatc
aaagtagacaaggtgcagatcatcggctccagcagctgccccttcgccgtgtgtctggac
caggacgagaggaagatcctgcagagcgtggtcaggtgtgaggtctctccctgctacaag
ccggagaagagcagcctcagcccaccagcccagacgccccccgacctgccagcccgggcg
gcccctgacctctgctccctcctctgcctgcccatcatgaccttcagcggggccctgccc
tag

KEGG   Oryctolagus cuniculus (rabbit): 100340526
Entry
100340526         CDS       T03373                                 
Symbol
PIK3R6
Name
(RefSeq) phosphoinositide-3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04371  Apelin signaling pathway
ocu04611  Platelet activation
ocu04725  Cholinergic synapse
ocu04921  Oxytocin signaling pathway
ocu05145  Toxoplasmosis
ocu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100340526 (PIK3R6)
   04072 Phospholipase D signaling pathway
    100340526 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    100340526 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    100340526 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100340526 (PIK3R6)
   04062 Chemokine signaling pathway
    100340526 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100340526 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100340526 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    100340526 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100340526 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100340526 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340526 (PIK3R6)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100340526 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 100340526
NCBI-ProteinID: XP_017204708
Ensembl: ENSOCUG00000004052
LinkDB
Position
19:10496960..10544714
AA seq 761 aa
MESSDVELDLQRSVQAVLRELSAQVPALQSNQAGMWRWSLHKKLERDPARSPTLVRILLR
ELEKAESEDLRHVIIPLLHTLMYVLTKATGIPEELYRRTYAFCTRLLTLPAPYCTVALDC
AIRLKTEAAVPGTLYQRTVIAEQNLMSELYPYQERVFLFVDPELVSASVCTALLLEIQAA
QGQQTPEACMRHVVSHALQAALGEACHVGALHQKLQASPRRTLERYFHAVVAAVEQVASE
GSPSRAGHLERLEEIYCSLLGPAAAARGHRAGDPTQDRPPSTPLPSPYITFHLWTDEEQL
WKELLLFLRPQSQPRLSADLEALDLQGFRPDRDMARVSVLSTDSGIERDLPLGPEELPAP
GSPELERVGLQRKGGVKKRAWPPDLLMPAGWAGPSGLHRRTGRPGSDGELLPGVSRLHTA
RVLVLGDDRMLGRLAQAYHRLRKRETQKFCLTPRLSLQLYYIPVLGPQQSTTSGQLELGE
LAELAVFLGRADPWYESTVNTLCAAIHKLAEMPPSLDTSRAVDPFILDGITYYVRMGTHP
VYFQIYMVKIFFSDPSQDPVEDVFLTELKAKIQDSKSPKDGFSPRRRGVAESLGAELSMC
YQKALLSHRPREVTVSLRSTGLVLKTIPTGDTEVAGTPLCPAAAAPVTDHTCLHVSVTEV
IKSSNLAGRSFSTVTNTFRTANIQIHSQDQRPLTLTLDKDSRRTFKDVIRFQVAPCPEPS
SETQKSKPSWLSSHGQQPMETTKAQPRPLRMPINTFSGIIQ
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagctggatctgcagaggagcgtacaagctgtgctccgggag
ctcagcgcccaggtccccgccctgcagagcaaccaagcaggcatgtggaggtggtccctg
cacaagaagctcgagcgagatcctgctaggagtcccacgctggttcgcattctgctcagg
gaactggaaaaggcagagagcgaggacctgcggcacgtcatcattcccttgctgcacacc
ctcatgtacgtgctcacgaaggccacgggcatccccgaggagctgtaccgcaggacctat
gccttctgcaccaggctcctgaccctgcctgcgccctactgcacagttgccttggactgc
gccatcaggctcaagaccgaggcggccgtgcccgggacgctataccagaggactgtcatc
gctgaacagaacctgatgagcgagctgtatccctaccaagagagagtgttcctcttcgtg
gatccggagctggtgtctgcatctgtgtgcacggctctgctgctggagatccaggcggcc
caggggcagcagacgcccgaggcctgcatgcgccacgtggtctcccacgccctgcaggcg
gctctgggggaggcctgccacgtgggcgcactgcaccagaagctgcaggccagcccccgc
cgcaccctggagcgctatttccacgccgtggtggcagccgtggagcaggtggcaagcgag
ggcagcccgagccgcgccggacacctggagcggctggaggagatttactgctcgctgctg
ggcccggcagccgccgccagggggcatcgcgcaggtgaccccacccaggaccggccacca
agcacccccctgcccagcccctacatcactttccacctgtggacggacgaggagcagctc
tggaaggagctgctgctcttcctccgcccacagtcccagccacgcctcagcgctgacctg
gaggccttggatctgcagggcttccggccagaccgggacatggcccgagtgtccgtgctg
tccacggacagcggcatcgagcgtgaccttcctctggggcccgaggagctgccggcgccc
ggcagcccagagctggagcgtgtggggctgcagcgcaaagggggcgtcaagaagcgggcg
tggcctccggacctcctgatgcctgctggctgggccgggccctcagggctgcaccgcagg
acgggcaggcccggcagtgatggggagctactgcccggtgtctcccggctgcacacggcc
cgcgtgctggtgctgggtgatgacaggatgctgggacgcctggcccaggcctaccacaga
ctcaggaaacgggagacccagaagttctgcctcacccccaggctcagcctgcagctctac
tacatccccgtgctggggccacagcagtccactacgtccgggcagctggagctgggggag
ctggcggagctggccgtgttcctgggccgcgcagacccctggtacgagagcacggtgaac
accctgtgtgccgccatccacaagctggctgagatgcctccctccctggacacttcccgg
gccgtggaccccttcatcctggatggtatcacctactacgtccgcatgggcacccacccc
gtctacttccagatctacatggtcaagatcttcttcagtgaccccagccaagaccccgtg
gaggatgtttttctcaccgagctgaaggccaagatccaagactccaagtcccccaaagat
gggttttcccctaggaggcgaggtgtggccgagagcctgggggctgagctgtccatgtgc
taccagaaggccttgctcagccacagaccccgggaggtcactgtctccctgcggagcact
gggctggtcctgaagaccatcccgactggtgacactgaagtcgcagggaccccgctctgc
cccgctgctgctgctccggtgacagaccacacgtgtctgcatgtcagtgtgacggaggtc
atcaagtcctccaacctggcaggaagatccttctccacagttaccaacaccttccggaca
gccaacatccagatccacagccaggaccagaggccgctgaccctgaccctggacaaagac
agtcggcgcacgttcaaggacgtaatcaggttccaggtcgctccctgcccagagccgtct
tccgagacccagaagtccaagccatcgtggctcagttcccacgggcagcagccgatggag
accaccaaagcccagcccagaccccttcgcatgcccatcaacacattctccggcatcatc
cagtga

KEGG   Oryctolagus cuniculus (rabbit): 100344144
Entry
100344144         CDS       T03373                                 
Symbol
PIK3CG
Name
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu00562  Inositol phosphate metabolism
ocu01100  Metabolic pathways
ocu04022  cGMP-PKG signaling pathway
ocu04062  Chemokine signaling pathway
ocu04072  Phospholipase D signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04371  Apelin signaling pathway
ocu04611  Platelet activation
ocu04725  Cholinergic synapse
ocu04921  Oxytocin signaling pathway
ocu05132  Salmonella infection
ocu05145  Toxoplasmosis
ocu05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100344144 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100344144 (PIK3CG)
   04072 Phospholipase D signaling pathway
    100344144 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    100344144 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    100344144 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100344144 (PIK3CG)
   04062 Chemokine signaling pathway
    100344144 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100344144 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100344144 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    100344144 (PIK3CG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100344144 (PIK3CG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100344144 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100344144 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100344144 (PIK3CG)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100344144 (PIK3CG)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100344144 (PIK3CG)
SSDB
Motif
Pfam: PIK3CG_ABD PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 100344144
NCBI-ProteinID: XP_002712080
Ensembl: ENSOCUG00000012739
UniProt: G1T3Z0
LinkDB
Position
7:43349493..43383146
AA seq 1102 aa
MELESSEQPVVLREDHGRRRRRMKPRSPAASLSSMELIPIEFVLPTSQRDSKTPETALLH
VAGHGNVEQMKGQVWLRALETSVAADFYHRLGPDHFLLLYQKKGQWYEIYDKYQVVQTLD
CLRYWKLLHRSPGQIHVVQRHAPSEETLAFQRQLTALIGYDVTDVSNVHDDELEFTRRRL
LTPRMAEVASRDPRLYAMHPWVTSKPLPEYLARKITNNCIFIVIHRSTTSQTIKVSADDT
PGNILHSFFTKMAKKKSLMDIPESQSEQDFVLRVCGRDEYLVGETPIRNFQWVRQCLKNG
EEIHLVLDAPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRK
FRVKVRGIDIPVLPRNADLTVFVEANIQHGQQVLCQRRTSAKPFTEEVLWNVWLEFSIKI
KDLPKGALLNLQIYCGKAPALSGKASADTPGAESRGKAQLLYYVNLLLIDHRFLLRHGEY
VLHMWQISGKGEDQGSFNADKLTSATNPDKENAMSISILLDNYCHPIALPKHRPTPDPEG
DRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYETLKHPKAYPKLFSSVKWGQ
QETVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYL
LQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAY
LRGCGTAMLHDLTQQVLVIEMLQKVTIDIKSLSAEKYDVSSQVILQLKQKLENLQNSNLP
TSFRVPYDPGLKAGTLVIEKCKVMASKKKPLWLEFKCADPTALSKETIGIIFKHGDDLRQ
DMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTG
AFKDEVLNHWLKEKCPIEDKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMISETGNL
FHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDVCVKAYLAL
RHHTNLLIVLFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYFLDQIEVCRDKGW
TVQFNWFLHLVLGIKQGEKHSA
NT seq 3309 nt   +upstreamnt  +downstreamnt
atggagctggagagctctgaacagcccgtggttctgagagaggaccacgggcgccggcgc
cggaggatgaagccgcgcagccccgcggccagcctgtcctccatggagctcatccccatc
gagttcgtgctgcccaccagccagcgcgacagcaagacgccggagacggcgctgctgcac
gtggcgggccacggcaacgtggagcagatgaagggccaggtgtggctgcgcgcgctggag
acgagcgtggccgcagacttctaccaccggctgggcccggaccacttcctcctgctctac
cagaaaaaggggcagtggtacgagatctacgacaagtaccaggtggtgcagacgctggac
tgcctgcgctactggaagctgctgcacaggagcccgggccagatccacgtagtccagcgg
cacgcgccctctgaggagacgctggcctttcagcggcagctcaccgccctgattggctat
gatgtgactgacgtcagcaacgtgcacgacgacgagctggagttcacgcgccggcgcctg
ctgactccacgcatggcggaagtggccagccgcgacccccggctgtacgccatgcacccc
tgggtgacgtccaagcccctgccggagtacctagcgaggaagattaccaacaactgcatc
ttcatcgtcatccaccgcagcaccaccagccagaccatcaaggtctcggccgacgacacg
cctggcaacatcctccatagcttcttcaccaagatggccaagaagaagtccctgatggac
atcccggagagccaaagcgaacaggattttgtgctgcgcgtctgcggccgggatgagtac
ctggtgggtgaaacgcccatcagaaatttccagtgggtgaggcagtgcctgaaaaatgga
gaggagattcacctagtgctcgacgcgcccccggacccagccctggacgaggtgaggaag
gaagagtggcccctggtggatgactgcacgggagtcaccggctaccacgagcagctgacc
atccacggcaaggaccatgagagcgtgttcactgtgtcgctgtgggactgtgaccggaag
ttcagggtcaaggtcagagggatcgatatcccggtcctgccgcggaacgccgacctcacg
gttttcgtggaggcaaacatccagcacgggcagcaagtgctttgccaaaggagaaccagc
gccaagcccttcacggaggaggtgctctggaatgtgtggctggagttcagtatcaaaatc
aaggacttgcccaagggcgcgcttctgaacctgcagatctactgcggcaaggcgcccgcg
ctgtcgggcaaggcctctgccgacactcccggtgcagagtccaggggcaaggctcagctg
ctctattacgtgaacctgctgctgatagatcatcgcttcctcctgcgccacggcgagtac
gtgctccacatgtggcagatatcgggcaagggagaagaccaggggagcttcaatgctgac
aagctcacgtctgcaaccaaccccgacaaggagaacgccatgtccatctccattcttctg
gacaattactgccacccaatagctttgcctaagcatcgacccacccctgaccctgaaggg
gaccgggtacgagccgaaatgcccaaccagcttcgcaagcagctggaagcaatcatagcc
acggatccacttaacccgctcacagcagaagacaaagagctgctgtggcattttagatac
gagacccttaagcatccgaaagcgtatcctaagctgtttagctcggtgaaatggggacag
caagaaactgtggccaaaacataccagttgttagcccgacgggaggtctgggatcaaagt
gctttggatgtggggttaacaatgcaactcctggactgcaacttttcggatgagaatgta
agagccattgcagttcagaaactggagagcttagaagatgatgatgtcttgcattacctt
ctgcagctggtccaggccgtgaaatttgaaccataccatgacagtgccctggccagattt
ctgctgaagcgtggtttaaggaacaaaagaattggtcacttcttgttttggttcttgaga
agtgagatagcccagtccagacactatcagcagaggttcgccgtgatcctggaagcctat
ctgaggggctgtggcacagccatgctgcacgacttgacccaacaagtccttgtaatcgag
atgttacaaaaagtcaccattgacattaaatcactctctgctgaaaagtatgacgtcagt
tcccaagttattctacagcttaagcaaaaacttgaaaatctacaaaattctaacctcccg
acgagttttagagttccatacgaccctggattgaaagcaggaacactggtgattgagaaa
tgtaaagtgatggcctccaagaaaaagcccctgtggctcgagtttaaatgtgccgatcct
acagccctttcaaaggagaccattggaattatctttaaacatggtgacgatctacgccaa
gacatgcttattttacagattctacgaatcatggagtccatctgggaaacagaatctttg
gatctgtgcctcttgccatatggttgcatttcaactggtgacaaaataggaatgatcgag
atcgtgaaagacgccacgaccattgccaaaattcagcaaagcaccgtgggcaacacgggc
gcctttaaggatgaagtcttgaaccactggctcaaggaaaaatgcccgattgaggacaag
tttcaggcagcagtggagagatttgtttattcctgtgcaggctactgtgtggcaaccttt
gttcttggaataggtgacagacacaacgacaatattatgatctccgagacaggaaaccta
ttccatatcgacttcgggcacattcttgggaactacaaaagtttcctgggcattaataaa
gagagagtgccatttgtgctaaccccagacttcctgtttgtgatggggacttctgggaag
aagacaagtccacacttccagaaatttcaggacgtctgtgtcaaggcctacctcgccctt
cgccatcacacaaacctgctgatcgtcctcttctccatgatgctgatgacagggatgccc
cagctaacaagcaaagaagacatcgagtacatccgggacgccttaacggtgggcaagagt
gaggaggacgccaagaagtattttcttgatcagattgaagtttgcagagacaaagggtgg
accgtgcagtttaactggttcctgcatcttgttttgggcatcaaacaaggagagaagcat
tcagcctga

DBGET integrated database retrieval system