Oryctolagus cuniculus (rabbit): 100337999 Help Entry 100337999         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 10 isoform X1   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04024   cAMP signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04141   Protein processing in endoplasmic reticulum ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04217   Necroptosis ocu04310   Wnt signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04530   Tight junction ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04920   Adipocytokine signaling pathway ocu04926   Relaxin signaling pathway ocu04930   Type II diabetes mellitus ocu04931   Insulin resistance ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05212   Pancreatic cancer ocu05231   Choline metabolism in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100337999  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100337999    04310 Wnt signaling pathway     100337999    04668 TNF signaling pathway     100337999    04068 FoxO signaling pathway     100337999    04071 Sphingolipid signaling pathway     100337999    04024 cAMP signaling pathway     100337999  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100337999    04137 Mitophagy - animal     100337999   09143 Cell growth and death    04215 Apoptosis - multiple species     100337999  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100337999    04660 T cell receptor signaling pathway     100337999    04658 Th1 and Th2 cell differentiation     100337999    04659 Th17 cell differentiation     100337999    04657 IL-17 signaling pathway     100337999    04664 Fc epsilon RI signaling pathway     100337999   09152 Endocrine system    04917 Prolactin signaling pathway     100337999    04926 Relaxin signaling pathway     100337999    04935 Growth hormone synthesis, secretion and action     100337999   09156 Nervous system    04728 Dopaminergic synapse     100337999    04723 Retrograde endocannabinoid signaling     100337999    04722 Neurotrophin signaling pathway     100337999   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100337999   09158 Development and regeneration    04380 Osteoclast differentiation     100337999  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100337999    05208 Chemical carcinogenesis - reactive oxygen species     100337999    05231 Choline metabolism in cancer     100337999   09162 Cancer: specific types    05210 Colorectal cancer     100337999    05212 Pancreatic cancer     100337999   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100337999    05170 Human immunodeficiency virus 1 infection     100337999    05161 Hepatitis B     100337999    05171 Coronavirus disease - COVID-19     100337999    05162 Measles     100337999    05167 Kaposi sarcoma-associated herpesvirus infection     100337999    05169 Epstein-Barr virus infection     100337999   09171 Infectious disease: bacterial    05135 Yersinia infection     100337999    05133 Pertussis     100337999    05152 Tuberculosis     100337999   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100337999    05142 Chagas disease     100337999   09164 Neurodegenerative disease    05010 Alzheimer disease     100337999    05012 Parkinson disease     100337999    05016 Huntington disease     100337999    05017 Spinocerebellar ataxia     100337999    05020 Prion disease     100337999    05022 Pathways of neurodegeneration - multiple diseases     100337999   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100337999    05418 Fluid shear stress and atherosclerosis     100337999    05415 Diabetic cardiomyopathy     100337999   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100337999    04936 Alcoholic liver disease     100337999    04932 Non-alcoholic fatty liver disease     100337999    04931 Insulin resistance     100337999    04933 AGE-RAGE signaling pathway in diabetic complications     100337999   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100337999  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100337999 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100337999 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100337999 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 Kinase-like APH FTA2 Motif Other DBs NCBI-GeneID:  100337999 NCBI-ProteinID:  XP_017202927 Ensembl:  ENSOCUG00000010663 LinkDB All DBs Position 15:complement(62662369..62990547) Genome browser AA seq 464 aa AA seqDB search MSLHFLYYCSEPTLDVKLAFCQGFDKQVDVSYIAKYYNMSKSKVDNQFYSVEVGDSTFTV LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH KNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACSSFMMTPYVVTRYYRAPEVILGMGY KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN VWYDPAEVEAPPPQIYDKQLDEREHTIDEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA VNSSESLHPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt atgagcctccatttcttatactactgcagtgaaccaaccttggatgtgaaacttgccttt tgtcagggatttgataaacaagtggatgtgtcatatattgccaaatattacaacatgagc aaaagcaaagtggacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt ctcaagcgctaccagaacctaaagcctattggctctggggctcagggaatagtttgtgct gcctatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag aaccaaacgcatgccaagagagcttaccgggagctggtcctcatgaagtgtgtgaaccat aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggaattccaa gatgtctacctggtcatggaactgatggacgccaacttgtgtcaggtgattcagatggaa ttagaccatgagcgaatgtcttacctgctctatcagatgttgtgtggcattaagcacctc cactctgctggaattatccacagggatttaaaacccagtaacattgtagtcaaatccgat tgcacgttgaaaatcctcgactttggactggccaggacagcatgctccagcttcatgatg actccgtatgtggtgacacgttattacagagccccagaggtcatcctgggaatgggctac aaggagaatgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa atcctctttccaggaagggactatatcgaccagtggaacaaagtcattgagcaactagga acgccgtgtccagaattcatgaagaaattgcagcctacagtaagaaactatgtggagaac cggcccaagtatgcgggactcaccttccccaagctctttccagattccctcttcccagca gactccgagcacaataagctcaaagccagccaagccagggacttgttgtcaaagatgcta gtgattgacccagcaaagaggatatcggtggatgacgccttacagcatccttacatcaac gtctggtatgaccccgccgaagtggaagcgcctccacctcagatatacgacaagcagctg gatgaaagagaacacaccattgacgagtggaaagaacttatctacaaggaagtaatgaat tcagaagaaaagactaagaatggcgtagtgaaaggacagccttctccttcaggtgcagca gtgaacagcagtgagagtctccatccatcctcgtctgtcaacgacatctcctccatgtcc accgaccagaccctggcgtctgacactgacagcagcctggaagcctcggcaggacccctg ggttgttgcaggtga

Oryctolagus cuniculus (rabbit): 100341695 Help Entry 100341695         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 14 isoform X1   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04015   Rap1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04114   Oocyte meiosis ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05205   Proteoglycans in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100341695    04668 TNF signaling pathway     100341695    04068 FoxO signaling pathway     100341695    04071 Sphingolipid signaling pathway     100341695  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100341695   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100341695  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100341695    04613 Neutrophil extracellular trap formation     100341695    04620 Toll-like receptor signaling pathway     100341695    04660 T cell receptor signaling pathway     100341695    04658 Th1 and Th2 cell differentiation     100341695    04659 Th17 cell differentiation     100341695    04657 IL-17 signaling pathway     100341695    04664 Fc epsilon RI signaling pathway     100341695    04670 Leukocyte transendothelial migration     100341695   09152 Endocrine system    04917 Prolactin signaling pathway     100341695    04926 Relaxin signaling pathway     100341695    04935 Growth hormone synthesis, secretion and action     100341695   09156 Nervous system    04728 Dopaminergic synapse     100341695    04723 Retrograde endocannabinoid signaling     100341695    04722 Neurotrophin signaling pathway     100341695   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100341695   09158 Development and regeneration    04380 Osteoclast differentiation     100341695   09159 Environmental adaptation    04714 Thermogenesis     100341695  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100341695    05208 Chemical carcinogenesis - reactive oxygen species     100341695    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100341695   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100341695    05161 Hepatitis B     100341695    05171 Coronavirus disease - COVID-19     100341695    05163 Human cytomegalovirus infection     100341695    05167 Kaposi sarcoma-associated herpesvirus infection     100341695    05169 Epstein-Barr virus infection     100341695   09171 Infectious disease: bacterial    05135 Yersinia infection     100341695    05133 Pertussis     100341695    05152 Tuberculosis     100341695   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100341695    05140 Leishmaniasis     100341695    05142 Chagas disease     100341695   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100341695    05020 Prion disease     100341695    05022 Pathways of neurodegeneration - multiple diseases     100341695   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100341695    05418 Fluid shear stress and atherosclerosis     100341695    05415 Diabetic cardiomyopathy     100341695   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100341695    04932 Non-alcoholic fatty liver disease     100341695    04933 AGE-RAGE signaling pathway in diabetic complications     100341695   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100341695  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100341695 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100341695 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100341695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Motif Other DBs NCBI-GeneID:  100341695 NCBI-ProteinID:  XP_002714691 Ensembl:  ENSOCUG00000014799 UniProt:  A0A5F9DKW1 LinkDB All DBs Position 12:complement(129647341..129750008) Genome browser AA seq 360 aa AA seqDB search MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA QALAHDYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt atgtctcaggagaggcccacgttctatcggcaggagctgaacaagacaatctgggaggtg cccgagcgttaccagaatctgtccccggtgggctctggcgcctatggctccgtgtgtgct gcttttgacacaaaaactgggttgcgcgttgctgtgaagaagctgtccaggccttttcag tccatcattcatgccaaaaggacctacagggagctgcggctactcaaacatatgaaacat gaaaatgtgattggtctattggacgtctttacacctgcaaggtctctggaggagttcaat gacgtgtatctggtgacgcatctcatgggggcagatctgaacaacattgtgaaatgccaa aagcttacagatgaccacgttcagttccttatctaccaaatcctccgaggcctaaagtat atacattcagcggacataattcacagggacctaaagcctagtaacctagctgtgaacgaa gactgtgagctgaagatcctggattttgggttggcgcgacacactgatgatgaaatgacg ggctacgtggccaccaggtggtatcgggctcctgagatcatgctgaactggatgcattac aaccagacagttgatatttggtcggtcggatgcataatggcggagctgttgactggaaga acactgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag tctttgacccagatgccgaagatgaactttgcaaatgtatttattggtgccaaccccttg gccgttgacctgctggagaagatgcttgttttggactcagataagagaatcacagcagcc caagccctcgcgcacgactactttgcccagtaccacgatccggacgacgagccggtggcc gacccttacgatcagtcttttgaaagcagggacctgctcatagacgagtggaaaagcctg acctatgatgaagtcatcagcttcgtgccgccacccctcgaccaagaagagatggagtcc tga

Oryctolagus cuniculus (rabbit): 100342664 Help Entry 100342664         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 9 isoform X2   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04024   cAMP signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04141   Protein processing in endoplasmic reticulum ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04217   Necroptosis ocu04310   Wnt signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04530   Tight junction ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04920   Adipocytokine signaling pathway ocu04926   Relaxin signaling pathway ocu04930   Type II diabetes mellitus ocu04931   Insulin resistance ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05212   Pancreatic cancer ocu05231   Choline metabolism in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100342664  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100342664    04310 Wnt signaling pathway     100342664    04668 TNF signaling pathway     100342664    04068 FoxO signaling pathway     100342664    04071 Sphingolipid signaling pathway     100342664    04024 cAMP signaling pathway     100342664  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100342664    04137 Mitophagy - animal     100342664   09143 Cell growth and death    04215 Apoptosis - multiple species     100342664  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100342664    04660 T cell receptor signaling pathway     100342664    04658 Th1 and Th2 cell differentiation     100342664    04659 Th17 cell differentiation     100342664    04657 IL-17 signaling pathway     100342664    04664 Fc epsilon RI signaling pathway     100342664   09152 Endocrine system    04917 Prolactin signaling pathway     100342664    04926 Relaxin signaling pathway     100342664    04935 Growth hormone synthesis, secretion and action     100342664   09156 Nervous system    04728 Dopaminergic synapse     100342664    04723 Retrograde endocannabinoid signaling     100342664    04722 Neurotrophin signaling pathway     100342664   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100342664   09158 Development and regeneration    04380 Osteoclast differentiation     100342664  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100342664    05208 Chemical carcinogenesis - reactive oxygen species     100342664    05231 Choline metabolism in cancer     100342664   09162 Cancer: specific types    05210 Colorectal cancer     100342664    05212 Pancreatic cancer     100342664   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100342664    05170 Human immunodeficiency virus 1 infection     100342664    05161 Hepatitis B     100342664    05171 Coronavirus disease - COVID-19     100342664    05162 Measles     100342664    05167 Kaposi sarcoma-associated herpesvirus infection     100342664    05169 Epstein-Barr virus infection     100342664   09171 Infectious disease: bacterial    05135 Yersinia infection     100342664    05133 Pertussis     100342664    05152 Tuberculosis     100342664   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100342664    05142 Chagas disease     100342664   09164 Neurodegenerative disease    05010 Alzheimer disease     100342664    05012 Parkinson disease     100342664    05016 Huntington disease     100342664    05017 Spinocerebellar ataxia     100342664    05020 Prion disease     100342664    05022 Pathways of neurodegeneration - multiple diseases     100342664   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100342664    05418 Fluid shear stress and atherosclerosis     100342664    05415 Diabetic cardiomyopathy     100342664   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100342664    04936 Alcoholic liver disease     100342664    04932 Non-alcoholic fatty liver disease     100342664    04931 Insulin resistance     100342664    04933 AGE-RAGE signaling pathway in diabetic complications     100342664   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100342664  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100342664 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100342664 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100342664 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo RIO1 Kinase-like APH FTA2 Motif Other DBs NCBI-GeneID:  100342664 NCBI-ProteinID:  XP_002721353 Ensembl:  ENSOCUG00000015542 UniProt:  A0A5F9CRG3 LinkDB All DBs Position Unknown AA seq 424 aa AA seqDB search MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL EGCR NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaacgttc actgtcctaaaacgttaccagcagttgaaaccaattggctctggagcccaaggaatcgtt tgtgctgcttttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct tttcaaaatcaaactcatgcaaagagagcttatcgagaacttgtcctgttaaagtgtgtc aatcataaaaacataattagtttgttaaatgtatttacaccacaaaaaactctagaagaa tttcaagatgtgtatttggtgatggaattaatggatgctaacctatgtcaggtgattcac atggagctggaccatgagagaatgtcctaccttctttaccagatgctttgtggcatcaaa catctgcactcagccgggataattcacagagacttgaagcctagcaacattgtagtgaaa tcagactgcacccttaagatccttgattttggcctggcccggacagcgtgcaccaatttc atgatgaccccctatgtggtaacgcggtattatcgggcacctgaagtcatcctgggtatg ggctacaaagagaacgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc cataaagtcctgttcccaggaagagactatattgatcagtggaacaaagtcattgagcag ctaggaacaccgtccgcagagttcatgaagaaacttcagccaactgtgaggaactatgtg gaaaacagaccgaagtaccctggaatcaaatttgaagagctctttccagattggatattc ccatcagaatcagaacgagacaaaataaaaacgagtcaagccagggatctgttatcaaaa atgttggtgatcgaccccgacaagcggatctctgtggacgaggctctgcgccacccgtac atcactgtctggtacgatcctgccgaggcagaggcgccaccacctcagatttacgatgcc caattggaagaaagagaacatgcaattgaggagtggaaagagctaatttacaaagaagta atggactgggaagaaagaagcaagaatggtgttgtgaaagatcagccttcagatgcagca gtaagtagcaacgccactccttcccagtcgtcatctatcaatgacatctcatccatgtcc acggagcagacactggcctcagacacagacagcagtcttgatgcctcaacaggacctctg gaaggttgtcgatga

Oryctolagus cuniculus (rabbit): 100344161 Help Entry 100344161         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 13   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04015   Rap1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04114   Oocyte meiosis ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05205   Proteoglycans in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100344161    04668 TNF signaling pathway     100344161    04068 FoxO signaling pathway     100344161    04071 Sphingolipid signaling pathway     100344161  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100344161   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100344161  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100344161    04613 Neutrophil extracellular trap formation     100344161    04620 Toll-like receptor signaling pathway     100344161    04660 T cell receptor signaling pathway     100344161    04658 Th1 and Th2 cell differentiation     100344161    04659 Th17 cell differentiation     100344161    04657 IL-17 signaling pathway     100344161    04664 Fc epsilon RI signaling pathway     100344161    04670 Leukocyte transendothelial migration     100344161   09152 Endocrine system    04917 Prolactin signaling pathway     100344161    04926 Relaxin signaling pathway     100344161    04935 Growth hormone synthesis, secretion and action     100344161   09156 Nervous system    04728 Dopaminergic synapse     100344161    04723 Retrograde endocannabinoid signaling     100344161    04722 Neurotrophin signaling pathway     100344161   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100344161   09158 Development and regeneration    04380 Osteoclast differentiation     100344161   09159 Environmental adaptation    04714 Thermogenesis     100344161  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100344161    05208 Chemical carcinogenesis - reactive oxygen species     100344161    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100344161   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100344161    05161 Hepatitis B     100344161    05171 Coronavirus disease - COVID-19     100344161    05163 Human cytomegalovirus infection     100344161    05167 Kaposi sarcoma-associated herpesvirus infection     100344161    05169 Epstein-Barr virus infection     100344161   09171 Infectious disease: bacterial    05135 Yersinia infection     100344161    05133 Pertussis     100344161    05152 Tuberculosis     100344161   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100344161    05140 Leishmaniasis     100344161    05142 Chagas disease     100344161   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100344161    05020 Prion disease     100344161    05022 Pathways of neurodegeneration - multiple diseases     100344161   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100344161    05418 Fluid shear stress and atherosclerosis     100344161    05415 Diabetic cardiomyopathy     100344161   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100344161    04932 Non-alcoholic fatty liver disease     100344161    04933 AGE-RAGE signaling pathway in diabetic complications     100344161   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100344161  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100344161 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100344161 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100344161 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Kinase-like Kdo Motif Other DBs NCBI-GeneID:  100344161 NCBI-ProteinID:  XP_002714701 Ensembl:  ENSOCUG00000014799 LinkDB All DBs Position 12:complement(129618187..129626105) Genome browser AA seq 366 aa AA seqDB search MSLTRRRGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF QSEIFARRAYRELLLLKHMQHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM EFSEDKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG VPGAEFVQKLKDKAAKTYIQSLPQMPKKDFTQLFPRASPQAVDLLEKMLELDVDKRLTAS QALAHPFFEPFRDPEEETEAQQPFDDALEHEKLTVDEWKQHIYKEIMGFSPVTRKDSRRR SGMKLQ NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt atgagcctcacccggagaaggggcttctacaagcaggacgtcaacaagaccgcctgggag ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctacggcgccgtgtgc tccgccatcgacaagcggtctggggagaaggtggccatcaagaagcttagccggcccttc cagtcggagatcttcgccaggcgggcctaccgcgagctgctgctgctcaaacacatgcag catgagaacgtcattgggctcctggatgtctttaccccagcctcctccctgcgcagcttc catgacttctacctggtgatgcccttcatgcagacggatctacagaagatcatgggcatg gagttcagtgaggacaagatccagtacctggtttaccagatgcttaaaggtcttaagtac atccactctgctggggtggtccacagggacctgaagccaggaaacctggccgtcaacgag gactgtgaactgaagatcctggattttgggctggcgcggcacgcggacgccgagatgacg ggctacgtggtgacgcgctggtaccgagcacccgaggtcatcctcagctggatgcactac aaccagaccgtggacatctggtcggtgggctgcatcatggcggagatgctgaccgggaag acgctgttcaagggcaaggactacctagaccagctgacccagatcctgaaagtgaccgga gtgcccggggccgagtttgtgcagaagctgaaggacaaagcagccaaaacctacatccag tccctgccccagatgcccaagaaggacttcactcagctcttcccacgggccagcccccag gccgtagacctgctggagaagatgctggaactggacgtggacaagcgcctgacggcctcg caggccctcgcccaccccttctttgaacccttccgggaccccgaggaagagacggaggcc cagcagccgttcgatgacgccttggaacacgagaagctcacagtggatgaatggaagcag cacatctacaaggagattatgggcttcagccccgtgacgcggaaggactcacggcgccgg agtggcatgaagctgcagtga

Oryctolagus cuniculus (rabbit): 100346929 Help Entry 100346929         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 8 isoform X1   KO K04440   mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04012   ErbB signaling pathway ocu04014   Ras signaling pathway ocu04024   cAMP signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04137   Mitophagy - animal ocu04140   Autophagy - animal ocu04141   Protein processing in endoplasmic reticulum ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04217   Necroptosis ocu04310   Wnt signaling pathway ocu04380   Osteoclast differentiation ocu04510   Focal adhesion ocu04530   Tight junction ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04910   Insulin signaling pathway ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04920   Adipocytokine signaling pathway ocu04926   Relaxin signaling pathway ocu04930   Type II diabetes mellitus ocu04931   Insulin resistance ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05212   Pancreatic cancer ocu05231   Choline metabolism in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100346929  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100346929    04310 Wnt signaling pathway     100346929    04668 TNF signaling pathway     100346929    04068 FoxO signaling pathway     100346929    04071 Sphingolipid signaling pathway     100346929    04024 cAMP signaling pathway     100346929  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100346929    04137 Mitophagy - animal     100346929   09143 Cell growth and death    04215 Apoptosis - multiple species     100346929  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100346929    04660 T cell receptor signaling pathway     100346929    04658 Th1 and Th2 cell differentiation     100346929    04659 Th17 cell differentiation     100346929    04657 IL-17 signaling pathway     100346929    04664 Fc epsilon RI signaling pathway     100346929   09152 Endocrine system    04917 Prolactin signaling pathway     100346929    04926 Relaxin signaling pathway     100346929    04935 Growth hormone synthesis, secretion and action     100346929   09156 Nervous system    04728 Dopaminergic synapse     100346929    04723 Retrograde endocannabinoid signaling     100346929    04722 Neurotrophin signaling pathway     100346929   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100346929   09158 Development and regeneration    04380 Osteoclast differentiation     100346929  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100346929    05208 Chemical carcinogenesis - reactive oxygen species     100346929    05231 Choline metabolism in cancer     100346929   09162 Cancer: specific types    05210 Colorectal cancer     100346929    05212 Pancreatic cancer     100346929   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100346929    05170 Human immunodeficiency virus 1 infection     100346929    05161 Hepatitis B     100346929    05171 Coronavirus disease - COVID-19     100346929    05162 Measles     100346929    05167 Kaposi sarcoma-associated herpesvirus infection     100346929    05169 Epstein-Barr virus infection     100346929   09171 Infectious disease: bacterial    05135 Yersinia infection     100346929    05133 Pertussis     100346929    05152 Tuberculosis     100346929   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100346929    05142 Chagas disease     100346929   09164 Neurodegenerative disease    05010 Alzheimer disease     100346929    05012 Parkinson disease     100346929    05016 Huntington disease     100346929    05017 Spinocerebellar ataxia     100346929    05020 Prion disease     100346929    05022 Pathways of neurodegeneration - multiple diseases     100346929   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100346929    05418 Fluid shear stress and atherosclerosis     100346929    05415 Diabetic cardiomyopathy     100346929   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     100346929    04936 Alcoholic liver disease     100346929    04932 Non-alcoholic fatty liver disease     100346929    04931 Insulin resistance     100346929    04933 AGE-RAGE signaling pathway in diabetic complications     100346929   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100346929  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100346929 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100346929 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100346929 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 Kinase-like FTA2 APH Motif Other DBs NCBI-GeneID:  100346929 NCBI-ProteinID:  XP_051693488 Ensembl:  ENSOCUG00000002873 LinkDB All DBs Position Unknown AA seq 427 aa AA seqDB search MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFERLFPDVLFPADSEHNKLKASQARDLLSK MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV MDLEERTKNGVIRGQPSPLGAAVISGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAPA GPLGCCR NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt atgagcagaagcaagcgtgacaacaatttttatagtgtagagatcggagattctacattc acagtcctgaagcgatatcagaatctaaaacctataggttctggagctcaaggaatagtc tgtgcagcttatgatgccattcttgaaagaaatgttgccatcaagaagctaagccggccg tttcagaatcaaacgcatgctaagagggcctacagagagctggttcttatgaaatgtgtt aatcacaaaaatataattggccttttgaatgtttttacaccacagaaatctctagaagaa tttcaagatgtttacatagtcatggagctcatggatgcgaatctttgccaagtgattcag atggaactagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag caccttcactccgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa tcagactgcactttgaaaatccttgactttggactggccaggactgcaggaacaagcttt atgatgacgccttatgtggtgactcgctactacagagcgcctgaggtcatcctgggcatg ggctacaaggagaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag ctgggaacaccatgtcctgagttcatgaagaaactgcaaccaacagtaaggacttacgtg gaaaacagacctaagtatgccggatatagctttgagaggctcttccccgatgtgcttttc ccagctgactcggaacacaacaagcttaaagccagtcaggcaagggatttgctctctaaa atgctggtgatagatgcatctaagaggatctctgtagacgaagctctccagcacccatac atcaatgtctggtacgatccctctgaagcagaagccccaccaccaaagattcctgacaaa cagttagacgaaagggaacacacgatagaagaatggaaagaattgatatacaaggaagtg atggatttggaagaaagaaccaagaatggagttatacgagggcagccctctcctttaggt gcagcagtgatcagtggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct tcaatgtcaacagacccgactttggcctcggatacagacagcagtctggaagccccagct gggcctctgggctgctgtagatga

Oryctolagus cuniculus (rabbit): 100350614 Help Entry 100350614         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 12 isoform X2   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04015   Rap1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04114   Oocyte meiosis ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05205   Proteoglycans in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100350614    04668 TNF signaling pathway     100350614    04068 FoxO signaling pathway     100350614    04071 Sphingolipid signaling pathway     100350614  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     100350614   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100350614  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100350614    04613 Neutrophil extracellular trap formation     100350614    04620 Toll-like receptor signaling pathway     100350614    04660 T cell receptor signaling pathway     100350614    04658 Th1 and Th2 cell differentiation     100350614    04659 Th17 cell differentiation     100350614    04657 IL-17 signaling pathway     100350614    04664 Fc epsilon RI signaling pathway     100350614    04670 Leukocyte transendothelial migration     100350614   09152 Endocrine system    04917 Prolactin signaling pathway     100350614    04926 Relaxin signaling pathway     100350614    04935 Growth hormone synthesis, secretion and action     100350614   09156 Nervous system    04728 Dopaminergic synapse     100350614    04723 Retrograde endocannabinoid signaling     100350614    04722 Neurotrophin signaling pathway     100350614   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     100350614   09158 Development and regeneration    04380 Osteoclast differentiation     100350614   09159 Environmental adaptation    04714 Thermogenesis     100350614  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100350614    05208 Chemical carcinogenesis - reactive oxygen species     100350614    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100350614   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100350614    05161 Hepatitis B     100350614    05171 Coronavirus disease - COVID-19     100350614    05163 Human cytomegalovirus infection     100350614    05167 Kaposi sarcoma-associated herpesvirus infection     100350614    05169 Epstein-Barr virus infection     100350614   09171 Infectious disease: bacterial    05135 Yersinia infection     100350614    05133 Pertussis     100350614    05152 Tuberculosis     100350614   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100350614    05140 Leishmaniasis     100350614    05142 Chagas disease     100350614   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100350614    05020 Prion disease     100350614    05022 Pathways of neurodegeneration - multiple diseases     100350614   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100350614    05418 Fluid shear stress and atherosclerosis     100350614    05415 Diabetic cardiomyopathy     100350614   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100350614    04932 Non-alcoholic fatty liver disease     100350614    04933 AGE-RAGE signaling pathway in diabetic complications     100350614   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100350614  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     100350614 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      100350614 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    100350614 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Haspin_kinase UvrD_C Kinase-like Motif Other DBs NCBI-GeneID:  100350614 NCBI-ProteinID:  XP_008249684 Ensembl:  ENSOCUG00000007543 LinkDB All DBs Position Unknown AA seq 367 aa AA seqDB search MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR PFQSELFAKRAYRELRLLQHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM KHEKLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS EMTGYVVTRWYRAPEVILNWMHYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK VTGTPPADFVQKLRSADAKQYMQGLPECERKDFASVVTNASPLAVNLLEKMLVLDGDQRV TAAEALAHPYFESLHDTEDEPTAQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGAR VSKETAL NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt atgagctcgccgccaccggcccgcaagggcttttaccgccaggaggtgaccaagaccgcc tgggaggtgcgcgctgtgtaccaggacctgcagcccgtgggctcgggcgcctacggcgcc gtgtgctcggcagtggacagccgcacgggcgccaaggtggccatcaagaagctgtaccgt cccttccagtcggagctgttcgccaagcgtgcctaccgcgagctgcgcctgctccagcac atgcgccacgagaacgtgatcggcctgctggacgtgttcaccccagacgagaccctggac gacttcacagacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg aagcacgagaagctgagtgaggaccgcatccagttcctggtgtaccagatgctgaagggg ctgaagtacatccacgctgctggcgtcatccacagggacctgaagcccggcaacctggca gtgaatgaggactgtgagctgaagatcctggactttggcctggccaggcaggctgacagt gagatgactggctatgtggtgacccggtggtaccgggcccccgaggtcatcctgaactgg atgcactacacacagacagtggacatctggtcggtgggctgcatcatggcggagatgatt acggggaagacgctgttcaagggcagtgaccacctggaccagctgaaggagatcatgaag gtgacagggacgcctccggccgacttcgtgcaaaagctgcggagcgctgatgccaagcag tacatgcagggcctccccgagtgtgagaggaaggactttgcctccgtggtgaccaacgca agccctctggccgtgaacctcctggagaagatgctggtgctggacggggaccagcgggtg acagcggccgaggcgctggcccacccctacttcgagtccctgcacgacacggaggacgag cccacagcccagaagtacgacgactcctttgatgacgtggaccgcaccctggacgagtgg aagcgtgtcacttacaaagaggtgctcagcttcaagcctcccaggcagctgggggccagg gtctccaaggagacggccctgtga

Oryctolagus cuniculus (rabbit): 103346035 Help Entry 103346035         CDS       T03373                                  Name (RefSeq) mitogen-activated protein kinase 11 isoform X1   KO K04441   p38 MAP kinase [EC:2.7.11.24] Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04015   Rap1 signaling pathway ocu04068   FoxO signaling pathway ocu04071   Sphingolipid signaling pathway ocu04114   Oocyte meiosis ocu04148   Efferocytosis ocu04218   Cellular senescence ocu04261   Adrenergic signaling in cardiomyocytes ocu04370   VEGF signaling pathway ocu04380   Osteoclast differentiation ocu04550   Signaling pathways regulating pluripotency of stem cells ocu04611   Platelet activation ocu04613   Neutrophil extracellular trap formation ocu04620   Toll-like receptor signaling pathway ocu04621   NOD-like receptor signaling pathway ocu04622   RIG-I-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04664   Fc epsilon RI signaling pathway ocu04668   TNF signaling pathway ocu04670   Leukocyte transendothelial migration ocu04714   Thermogenesis ocu04722   Neurotrophin signaling pathway ocu04723   Retrograde endocannabinoid signaling ocu04728   Dopaminergic synapse ocu04750   Inflammatory mediator regulation of TRP channels ocu04912   GnRH signaling pathway ocu04914   Progesterone-mediated oocyte maturation ocu04917   Prolactin signaling pathway ocu04926   Relaxin signaling pathway ocu04932   Non-alcoholic fatty liver disease ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu04935   Growth hormone synthesis, secretion and action ocu04936   Alcoholic liver disease ocu05014   Amyotrophic lateral sclerosis ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05163   Human cytomegalovirus infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05205   Proteoglycans in cancer ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05415   Diabetic cardiomyopathy ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     103346035    04668 TNF signaling pathway     103346035    04068 FoxO signaling pathway     103346035    04071 Sphingolipid signaling pathway     103346035  09140 Cellular Processes   09141 Transport and catabolism    04148 Efferocytosis     103346035   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     103346035  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     103346035    04613 Neutrophil extracellular trap formation     103346035    04620 Toll-like receptor signaling pathway     103346035    04660 T cell receptor signaling pathway     103346035    04658 Th1 and Th2 cell differentiation     103346035    04659 Th17 cell differentiation     103346035    04657 IL-17 signaling pathway     103346035    04664 Fc epsilon RI signaling pathway     103346035    04670 Leukocyte transendothelial migration     103346035   09152 Endocrine system    04917 Prolactin signaling pathway     103346035    04926 Relaxin signaling pathway     103346035    04935 Growth hormone synthesis, secretion and action     103346035   09156 Nervous system    04728 Dopaminergic synapse     103346035    04723 Retrograde endocannabinoid signaling     103346035    04722 Neurotrophin signaling pathway     103346035   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     103346035   09158 Development and regeneration    04380 Osteoclast differentiation     103346035   09159 Environmental adaptation    04714 Thermogenesis     103346035  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     103346035    05208 Chemical carcinogenesis - reactive oxygen species     103346035    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     103346035   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103346035    05161 Hepatitis B     103346035    05171 Coronavirus disease - COVID-19     103346035    05163 Human cytomegalovirus infection     103346035    05167 Kaposi sarcoma-associated herpesvirus infection     103346035    05169 Epstein-Barr virus infection     103346035   09171 Infectious disease: bacterial    05135 Yersinia infection     103346035    05133 Pertussis     103346035    05152 Tuberculosis     103346035   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103346035    05140 Leishmaniasis     103346035    05142 Chagas disease     103346035   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103346035    05020 Prion disease     103346035    05022 Pathways of neurodegeneration - multiple diseases     103346035   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103346035    05418 Fluid shear stress and atherosclerosis     103346035    05415 Diabetic cardiomyopathy     103346035   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     103346035    04932 Non-alcoholic fatty liver disease     103346035    04933 AGE-RAGE signaling pathway in diabetic complications     103346035   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     103346035  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:ocu01001]     103346035 Enzymes [BR:ocu01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.24  mitogen-activated protein kinase      103346035 Protein kinases [BR:ocu01001]  Serine/threonine kinases: CMGC group   MAPK family [OT]    103346035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH RIO1 Cas_CT1975 Motif Other DBs NCBI-GeneID:  103346035 NCBI-ProteinID:  XP_051695176 LinkDB All DBs Position Unknown AA seq 364 aa AA seqDB search MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA EALAHAYFSQYHDPDDEPVAEPYDESVEAKERTVEEWKELTYQEVLSFKPPESPQPSGSL DIEQ NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt atgtcggggccccgcgccggcttctaccggcaggagctgaacaagacggtgtgggaggtg ccgcagaggctgcaggggctgcgcccggtgggctccggcgcctacggctcggtctgctca gcctacgacgcccggctgcggcagaaggtggcggtgaagaagctctcgcggcccttccag tcgctgatccacgcccgcaggacgtaccgggagctgcggctgctcaagcacctcaagcat gagaacgtcatcgggcttctggacgtcttcacgccagccacgtccatcgaggacttcagt gaagtgtacttggtgaccaccctgatgggcgcagacctgaacaacatcgtcaagtgccag gcgctgagtgacgaacacgtccagttcctggtataccagctgctgcgtgggctgaagtac atccactctgcagggatcatccaccgggacctgaaacccagcaacgtggcggtgaatgaa gactgcgagctcaggatcctagacttcggactggcccgccaggctgacgaggagatgacc ggctacgtggccacacgctggtaccgagccccagagatcatgctgaactggatgcactac aaccagacagtggatatctggtccgtgggctgtatcatggccgagctgctgcaggggaag gctctcttcccgggaagtgactacatcgaccagctgaagcggatcatggaggtggtgggt acgcccagccctgaggttctggccaagatttcctcggagcacgcccggacctacatccag tctctgccccccatgcctcagaaggacctcagcagcatcttccgcggagccaaccccctg gctatagatctcctcgggaggatgctggtgctggacagcgaccagcgggtcagcgccgcg gaggccctggcccacgcctacttcagccagtaccacgaccccgacgatgagccggtggcc gagccctatgatgaaagcgttgaggccaaggagcgcacagtggaggagtggaaggagctc acctaccaggaggttctcagcttcaagcccccggagtcaccacagccatctggtagcctg gacattgagcagtga

DBGET integrated database retrieval system