KEGG   Oryctolagus cuniculus (rabbit): 100338073
Entry
100338073         CDS       T03373                                 
Symbol
EPHA8
Name
(RefSeq) EPH receptor A8
  KO
K05109  Eph receptor A8 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100338073 (EPHA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100338073 (EPHA8)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100338073 (EPHA8)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100338073 (EPHA8)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 SAM_2 EphA2_TM Pur_ac_phosph_N fn3_2 Ephrin_rec_like Kdo SusE Interfer-bind ABC1
Other DBs
NCBI-GeneID: 100338073
NCBI-ProteinID: XP_017201969
Ensembl: ENSOCUG00000015119
LinkDB
Position
13:complement(130524253..130546577)
AA seq 1003 aa
PARGRLPPALWVVTAAAAAATCVSAARGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVDE
AFQPIHTYQVCNVMSPNQNNWLRTSWVPRDGARRVYAEIKFTLRDCNSMPGVLGTCKETF
NLYYLESDRDLGSSTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRGFY
LAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERDT
PKMYCSAEGEWLVPIGKCVCSAGYEERRDACVACELGFYKSAPGDQLCARCPPHSHSAAP
AAQACRCDLSYYRAALDPPSAACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDITY
NAVCRRCPWALSHCEACGSGPRFVPQQTSLVQASLLVANLLAHMNYSFWIEAVNGVSDLS
PEPRRAAVVNITTNQAAPSQVVVIRQERTGQTSVSLLWQEPEQPNGIILEYEIKYYEKDK
EMQSYSTLKAVTTSATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDTRT
IVWICLTLITGLVVLLVLLICKKRHCGYSKAFQDSDEEKMHYQSGQAPPPVFLPLHHPPG
KFPEPQICAEPHNYEEPGRAGRGFTREIEASRIHIEKIIGSGESGEVCYGWLRVPGQRDV
PVAIKALKAGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSLD
AFLRTHDGQFTIMQLVGMLRGVGAGMRYLSDLGYVHRDLAARNVLVGGDLVCKVSDFGLS
RVLEDDPEAAYTTTGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWNM
TNRDVISSVEEGYRLPAPMGCPRALHQLMLDCWHKDRAQRPRFSHIVSVLDALIRSPESL
RATATTSRCPPPAFARSCFDLRAGGGGGGGLTVGDWLDSIRMGRYRDHFAAGGYSSLGMV
LRMNAQDVRALGITLMGHQKKILGSIQTMRAQLSSTQGPRRHL
NT seq 3013 nt   +upstreamnt  +downstreamnt
ccccgcccggggccgcctgccccccgcgctctgggtcgtcacggccgcggcggcggcggc
cacctgcgtgtccgcggcgcgcggcgaagtgaacttgctggacacgtcgaccatccacgg
ggactggggctggctcacgtatccggctcacgggtgggactccatcaacgaggtggatga
ggccttccagcccattcacacgtaccaggtgtgcaacgtcatgagccccaaccagaacaa
ctggctgcgcacaagctgggtgccccgcgacggcgcacggcgcgtctacgccgagatcaa
gttcaccctgcgcgactgcaacagcatgcccggcgtgctgggcacctgcaaggagacctt
caacctctactacctggagtcggaccgcgacctgggctccagcacccaggagagccagtt
cctcaagatcgacaccatcgcggccgacgagagcttcaccggcgccgacctgggcgtgcg
gcggctcaagctcaacaccgaggtgcgcggcgtgggccccctcagcaagcgcggcttcta
cctggccttccaggacatcggcgcctgcctcgccatcctctctctccgcatctactacaa
gaagtgccccgccatggtgcgcaacctggccgccttctcggaggcggtgaccggggccga
ctcctcctcgctggtggaggtccggggccagtgtgtgcggcactcggaggagcgggacac
gcccaagatgtactgcagcgccgagggcgagtggctggtgcccattggcaagtgcgtgtg
cagtgccggctacgaggagcggcgggatgcctgtgtggcctgcgagctgggcttctacaa
gtcggcccctggggaccagctgtgtgcccgctgccctccccacagccactctgcagcccc
ggctgcccaggcctgccgctgtgacctcagctactaccgtgcagccctggacccgccgtc
tgcagcctgcacccggccgccctcagcacccgtgaacctgatctccagtgtgaatgggac
gtccgtgaccctggagtgggcccctcccctggaccccggcggccgcagcgacatcaccta
caacgccgtgtgccgccgctgcccctgggcactgagccactgcgaggcgtgcgggagcgg
cccccgcttcgtgccccagcagacgagcctggtgcaggccagcctgctggtggccaacct
gctggcccacatgaactactccttctggatcgaggccgtcaatggcgtgtccgacctgag
ccccgagccccgccgggccgccgtggtcaacatcaccacgaaccaggcagccccgtccca
ggtggtggtgatccggcaggagcgcacagggcagactagcgtgtcgctgctgtggcagga
gccggagcagcccaatggcatcatcctggagtacgagatcaagtactatgagaaggacaa
ggagatgcagagctactccacgctcaaggctgtcaccaccagtgccaccgtgtcaggcct
caagccgggcacgcgctacgtgttccaggtccgagcccgcacctcggcaggctgcggccg
cttcagccaggccatggaggtggagacggggaaaccccggccccgctacgacacccgcac
catcgtctggatctgcctgacgctcatcactggcctggtcgtgctcttggtcctgctcat
ctgcaagaagaggcactgcggctacagcaaggccttccaggactcggacgaggagaagat
gcattaccagagcgggcaggcgcccccacctgtcttcctgcccctgcaccaccccccagg
gaagtttccagagccccagatctgcgcagaaccccacaactacgaggagccgggccgggc
gggccgtggtttcacccgcgagattgaggcctcccggatccacatcgagaaaatcatcgg
ctccggagagtccggggaagtctgctacgggtggctacgggtgccggggcagcgggacgt
gcccgtggccatcaaggccctcaaagccggctacacggagaggcagaggcgggacttcct
gagcgaggcgtccatcatgggccagttcgaccaccccaacatcatccgccttgagggtgt
cgtcacacggggccgtctggcgatgatcgtgaccgagtacatggagaatggctctctgga
cgccttcctgaggacccacgacgggcagttcaccatcatgcagctggtgggcatgctccg
gggcgtgggcgccggcatgcgctacctctcggacctgggctacgtgcaccgcgacctggc
cgcccgcaacgtgctggtgggcggcgacctggtctgcaaagtgtctgacttcgggctctc
gcgcgtgctggaggacgacccagaggctgcctacaccaccacgggaggcaagatccccat
ccgctggacagcccctgaggccatcgccttccggaccttctcctcggccagcgacgtgtg
gagcttcggggtggtcatgtgggaggtgctggcctacggggagcggccctactggaacat
gaccaaccgggacgtcatcagctcggtggaggaggggtaccggctgccggcgcccatggg
ttgcccccgcgccctgcaccagctcatgctggactgttggcacaaggaccgggcccagcg
gccccgcttctcccacatcgtcagcgtcctcgatgcgctgatccggagtcccgagagtct
gcgggccacggccactaccagcaggtgcccgccccctgcctttgcccgcagctgctttga
cctgcgagcaggtgggggtgggggcgggggcctcacggtgggggactggctggactccat
ccgcatgggccgctaccgagaccacttcgccgctggcggatactcctccctgggcatggt
gctgcggatgaacgcgcaggacgtgcgtgccctgggcatcaccctcatgggccaccagaa
gaagatcctaggcagcatccagaccatgagagcgcagctgagcagcacccagggcccgcg
ccggcacctctga

KEGG   Oryctolagus cuniculus (rabbit): 100338483
Entry
100338483         CDS       T03373                                 
Symbol
EPHA1
Name
(RefSeq) EPH receptor A1
  KO
K05102  Eph receptor A1 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100338483 (EPHA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100338483 (EPHA1)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100338483 (EPHA1)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100338483 (EPHA1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 SAM_2 EphA2_TM Pur_ac_phosph_N Ephrin_rec_like ABC1 Tissue_fac Haspin_kinase
Other DBs
NCBI-GeneID: 100338483
NCBI-ProteinID: XP_008256312
Ensembl: ENSOCUG00000011082
LinkDB
Position
7:8696543..8711410
AA seq 975 aa
MERRWPLGLGLLLLLLPPPPGARAKEVTLMDTSTAQGELGWLPDPPEDGWSEVQQMLNGT
PLYMYQDCPMQEGGDTDHWLRSNWIYRGEEASRVHVELQFTVRDCKSFPGGAGPLGCKET
FNLLYMESDQDVGIQLRRPLFQKVTTVAADQSFTIRDLASGSMKLNVERCSLGHLTRRGL
YLAFHNPGACVALVSVRVFYQRCPEAVHSLAQFPDTLPGPVGLVEVAGTCLPHAQSSAGP
SGAPRMHCSPDGEWLVPVGQCHCEPGYEEGDGGTACIACPSDSYRTDVSTPHCLKCPQHS
TATSEGATICTCDSGHYRAPGEGPQEACTRPPSAPQNLSFSASGTQLSLRWEPPADMGGR
QDVRYSVGCSQCQGSAQDGGPCQPCGASVRFSPGNRELTVPRVRVDGLEPYTNYTFNVEA
QNGVSGLGSSSPASASLSIGMGHAESLSGLSLRLVKKEPRQLELTWAGSWPRSPGGNLTY
ELHVLNQDEERHQMVLEPRVLLTELQPDTTYIVRVRMLTPLGPGPFSPDHEFRTSPPVSR
GLTGGEIVAIIFGLLLGVALLLGILVFRSRRGQRQRQQRPRDHVTDVDREDKLWLKPYVD
LQAYEDPAQGALDFTQELDPAWLVVDTVIGEGEFGEVYRGTLRVPSQDCKTVAIKTLKDT
SPDGQWWNFLREATIMGQFNHPHILHLEGVVTKRKPIMIITEFMEHGALDAFLREREGQL
VPGQLVAMLLGIASGMNYLSDHSYVHRDLAARNILVSQNLCCKVSDFGLTRLLDNFDGTY
ETQGGKIPIRWTAPEAIAHRIFTTASDVWSFGIVMWEVLSFGDKPYGEMSNQEVMKSIED
GYRLPPPVDCPAPLYELMKNCWAYDSARRPHFHQLQAHLEQLLANPHSLRTIANFDPRVT
LRLPSLSGSDGIPYRSVSEWLESIRMKRYILHFRSAGLDTMECVLELTAEDLTQMGITLP
GHQKRILCSIQGFKD
NT seq 2928 nt   +upstreamnt  +downstreamnt
atggagcggcgctggcccctggggctcgggctgctgctgctgctgctgccaccgcccccg
ggagcgcgcgccaaggaagtcactctgatggacacaagcactgcacagggagagttgggc
tggctgccggaccccccggaggatgggtggagtgaggtgcagcagatgctgaatgggacg
cccctgtacatgtaccaggactgtccaatgcaagaaggtggagacactgaccactggctc
cgctccaactggatctaccggggagaggaggcttcgcgtgtccacgtggagctgcagttc
accgtgcgagactgtaagagtttccctggaggagctggacctctgggctgcaaggagacc
ttcaaccttctgtacatggagagtgaccaggacgtgggcatccagctccgacggcccttg
ttccaaaaggtcaccacagtggctgcagaccagagcttcaccattcgagaccttgcatct
ggctccatgaagctgaatgtggagcgctgctccctgggccacttgacgcgccgtggcctc
taccttgccttccacaacccaggcgcctgtgtggccctggtgtccgtacgtgtgttctac
cagcgctgtcctgaggccgtgcacagcttggcccaattccctgacactctcccaggaccc
gttgggctggtggaagtggcagggacctgcttgccccatgcacagtccagcgcggggccc
tcgggtgcacctcgcatgcattgcagccccgatggcgagtggttggtgcctgtgggccag
tgccactgcgagcctggctatgaggaaggtgacggaggcacggcatgcattgcctgccct
agtgactcctaccggaccgacgtgagcacaccccattgtctcaagtgcccccagcacagc
acagccacctctgagggagccaccatctgtacctgtgacagtggccactacagagccccc
ggagagggcccccaggaggcatgcacacgtccaccctcggccccccaaaacctgagcttc
tctgcatcggggactcagctctccctgcgctgggagcctcctgcagatatggggggacgc
caggatgtcagatacagcgtagggtgctcccagtgccagggctcagcccaggacgggggg
ccctgccagccctgtggggccagtgtgcgcttctccccagggaacagggagctcacagta
cccagggtgcgcgtcgatggccttgaaccctacaccaactacaccttcaacgtggaagcg
cagaacggtgtgtcggggctggggagctccagtcccgccagcgcctccttgagcatcggc
atggggcatgcagagtcgctctcaggcctgtctctgagactggtgaagaaagaacccagg
cagctggagctgacctgggcagggtcctggccccgcagtcccggaggaaacctgacctat
gagctgcatgtgctgaaccaggacgaagaacggcaccagatggttcttgaacccagggtc
ttgctgacagaactgcagccagacaccacatatatcgtcagagttcggatgttgacgcca
ctgggccctggccccttctcacctgaccatgaattccggaccagccctccagtttccagg
ggtctgaccggaggagagatcgtggccatcatcttcgggctgctgcttggcgtggctctg
ctgctggggattctcgtgttccgttcaaggaggggacagcggcaacggcagcagaggcca
cgcgaccacgtcacagatgtggaccgagaggacaagctgtggctgaagccctacgtggac
ctccaggcctatgaggaccctgcgcagggagccctggacttcacccaagagctggaccca
gcctggctggtcgtggacactgtcataggggaaggagagtttggagaagtgtaccgaggg
accctgagggtccccagccaggactgcaagacggtggccattaagaccctgaaagacacc
tctcccgatggccagtggtggaacttccttcgagaagcgactatcatgggccagttcaac
caccctcacatcctgcatctagaaggcgtcgtcacaaagagaaagcccatcatgatcatc
acggagtttatggagcacggagccctggatgccttcctgagggagcgggaaggccagctg
gtccctgggcagctggtggccatgctgctgggcatagcgtccggcatgaactacctcagt
gaccacagttatgtccaccgggacctggctgccaggaacatcttggtgagtcagaacctg
tgctgcaaggtgtctgactttggcttgacccgtctcctggacaactttgatggcacctac
gaaacccagggaggaaagatccccattcgctggacagcccctgaagccattgcccaccga
atcttcaccacggccagtgacgtgtggagctttgggattgtgatgtgggaggtgctgagc
tttggggacaagccctacggggagatgagcaatcaggaggtgatgaagagcatcgaggat
gggtaccgactgccgcctcccgtggactgccctgctcctctgtatgaactcatgaagaac
tgctgggcatatgacagtgcccgccggccccacttccaccagctgcaggcgcacctggag
cagttgcttgccaacccccattccttgaggaccattgccaactttgaccccagggtcact
ctccgcctgcccagcctgagcggctcagatggcatcccttacagaagcgtgtctgagtgg
ctcgagtcgatccgcatgaaacgctacatcctgcacttccgctcggccgggctggacacc
atggagtgtgtgctggagctgacggctgaggacctgacgcagatgggaatcactctgccg
gggcaccagaagcgcattctttgcagtattcagggattcaaggactga

KEGG   Oryctolagus cuniculus (rabbit): 100343518
Entry
100343518         CDS       T03373                                 
Symbol
EPHA2
Name
(RefSeq) EPH receptor A2
  KO
K05103  Eph receptor A2 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04014  Ras signaling pathway
ocu04015  Rap1 signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100343518 (EPHA2)
   04014 Ras signaling pathway
    100343518 (EPHA2)
   04015 Rap1 signaling pathway
    100343518 (EPHA2)
   04151 PI3K-Akt signaling pathway
    100343518 (EPHA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100343518 (EPHA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100343518 (EPHA2)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100343518 (EPHA2)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100343518 (EPHA2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Pur_ac_phosph_N Interfer-bind ABC1 Ephrin_rec_like Haspin_kinase GAPT
Other DBs
NCBI-GeneID: 100343518
NCBI-ProteinID: XP_002722370
Ensembl: ENSOCUG00000000786
LinkDB
Position
Un
AA seq 977 aa
MERRGARAYLALLWGCALAAAAAAAQGKEVVLLDFAAAKGELGWLTHPYGKGWDLMQNIM
NDMPIYMYSVCNVVAGDQDNWLRTNWVYRGEAERIFIELKFTVRDCNSFPGGASSCKETF
NLYYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERSVGPLSRKGFY
LAFQDIGACVALLSVRVYYKKCPELLQGLAHFPETIAGSDAPSLATVAGTCVDHAVVPPG
GEEPRMHCAVDGEWLVPIGQCLCQAGYEKVEDACQACSPGFFKSEASESPCLECPEHTLP
SLEGATSCECEEGYFRAPQDPLSMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGRED
VVYFVTCEQCWPESGECGPCEASVRYSEPPHALTRTSLMVSDLEPHMNYTFAVEARNGVS
GLVTSRSFRTASVTINQTEPPKVRLEGRSTTSLSVAWTIPPPQQSRVWKYEVTYRKKGDS
NSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSVEGSGNMAVIG
GVAVGLVLLLLLAGIGVFIHRRRKNLRARQSSEDVYFSKSEQLKPLKTYVDPHTYEDPNQ
AVLKFTTEIHPSCITRQKVIGAGEFGEVYKGMLKASSGKKEVPVAIKTLKAGYTEKQRVD
FLSEASIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFGVLQLVGM
LRGIAAGMKYLANMNYVHRDLAARNILVNGNLVCKVSDFGLSRVLEDDPEATYTTSGGKI
PIRWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTP
MDCPSAIYQLMMQCWQQERARRPKFTDIVSILDKLIRAPESLKTLADFDPRVSIRLPSTS
GSEGVPFRTVSEWLESIRMQQYTEHFMAAGYTAIEKVVQMTNEDIKRIGVRLPGHQKRIA
YSLLGLKDQVNTVGIPI
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggagcgccggggagcccgcgcctacctcgcgctgctttggggctgcgctctggccgcg
gcggcggcggcggcgcagggcaaggaagttgttctgttggactttgcagcggccaagggg
gagctgggctggctcacgcacccgtacggtaaagggtgggacctgatgcaaaacatcatg
aacgacatgcccatctacatgtactccgtgtgcaacgtggtggccggcgaccaggacaac
tggctgcgcaccaactgggtgtaccggggcgaggccgagcgcatctttattgagctcaag
ttcacggtgcgcgactgcaacagcttccccggcggcgccagctcctgcaaggagaccttc
aacctctactacgccgagtcggatgtggactatggcaccaacttccagaagcgccagttc
accaagattgacaccatcgcgcccgacgagatcaccgtcagcagcgacttcgaggcgcgc
aatgtgaagctgaacgtggaggagcgctccgtggggccgctcagccgcaagggcttctac
ttggccttccaggacatcggcgcctgcgtggcgctgctctctgtccgcgtctactacaag
aagtgccccgagctgctgcagggcctggcccacttccccgagaccatcgccggctctgac
gcaccctctctggccaccgtggccggcacctgcgtggaccatgctgtggtgcccccgggc
ggtgaagagccccggatgcactgtgccgtggacggcgagtggctggtgcccatcgggcag
tgcttgtgccaggcaggctacgagaaggtggaggatgcctgccaggcctgctcgccggga
ttcttcaagtccgaggcatccgagagcccctgcctggagtgtcccgagcacacgctgccg
tccctggagggcgccacctcctgcgagtgtgaggaaggctacttccgggccccccaggac
ccactgtccatgccctgcacacgcccgccctccgccccgcactacctcacggccgtgggc
atgggcgccaaggtggagctgcgctggacgcctccccaggacagcgggggccgcgaggac
gtcgtctacttcgtcacctgcgagcagtgctggcccgagtcgggcgagtgtgggccgtgt
gaggccagcgtgcgctactcggagcctccgcacgctctgacccgcaccagcctgatggtc
agcgacctggagccccacatgaactacacattcgctgtggaagcccgcaacggcgtctcg
ggcctggtgaccagccgcagcttccgcaccgccagcgtcaccatcaaccagaccgagccc
cccaaggtgaggctggagggccgcagcaccacctcgctgagcgtggcctggaccatcccc
ccaccgcagcagagccgcgtgtggaagtacgaggtcacctaccgcaagaagggggactcc
aacagctacaatgtgcgccgcactgagggcttctctgtgaccctggacgacctggctccg
gacaccacctacctggtccaggtgcaggccctgacacaggagggccaaggggccggcagc
aaggtgcatgagttccagacgctgtccgtggaagggtctggcaacatggcggtgatcggt
ggtgtggctgtcggcctggtcttgcttctgctgttggcgggaattggcgtcttcattcat
cgcaggaggaagaacctgcgtgcccgccagtcctcggaggacgtgtacttctccaagtca
gagcaactgaagcccctgaagacgtacgtggacccccacacgtatgaggaccccaaccag
gccgtgctcaagttcaccaccgagatccacccgtcctgcatcacacggcagaaggtgatc
ggagcaggggagtttggggaggtgtacaaggggatgctaaaggcgtcctcggggaagaag
gaggtgcccgtggccatcaagacgctgaaggccggctacacggagaagcagcgggtggac
ttcctgagcgaggcgagcatcatgggccagttcagccaccacaacatcatccgcctggag
ggagtcgtctctaaatacaagcccatgatgatcatcaccgaatacatggagaacggggcc
ctggacaagttccttcgagaaaaggacggcgagttcggcgtgctgcagctggtgggcatg
ctgcggggcatcgcggcgggcatgaagtacctggccaacatgaactacgtgcaccgcgac
ctggccgcccgcaacatcctggtcaacggcaacctggtgtgcaaggtgtccgacttcggc
ctgtcccgcgtgctggaggatgaccccgaggccacctacaccaccagtggcggcaagatc
ccaatccgctggacggccccggaagccatttcctaccgcaagttcacctctgccagcgac
gtgtggagctacggcattgtcatgtgggaggtgatgacgtatggcgaacggccctactgg
gagctgtcgaaccacgaggtgatgaaagccatcaacgacggcttccggctgcccacgccc
atggactgcccctccgccatctaccagctcatgatgcaatgctggcagcaggagcgcgcc
cgccgccccaagttcacggacatcgtcagcatccttgacaagctcatccgagcccccgaa
tccctcaagaccctggctgactttgacccccgcgtgtccattcggctgcccagcaccagc
ggctccgagggcgtgcccttccgcacagtgtccgagtggctggagtccatcaggatgcag
cagtacacggagcacttcatggcggctggctacactgccatcgagaaagtggtgcagatg
accaacgaggacatcaagaggatcggggtgcgtctgcccggccaccagaagcgcatcgcc
tacagcctgctggggctcaaggaccaggtgaacacggtgggcatccccatctga

KEGG   Oryctolagus cuniculus (rabbit): 100344496
Entry
100344496         CDS       T03373                                 
Symbol
EPHA3
Name
(RefSeq) EPH receptor A3
  KO
K05104  Eph receptor A3 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100344496 (EPHA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100344496 (EPHA3)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100344496 (EPHA3)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100344496 (EPHA3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_2 SAM_1 Ephrin_rec_like Pur_ac_phosph_N fn3_2 ABC1 Interfer-bind Kdo Haspin_kinase Pkinase_fungal SusE
Other DBs
NCBI-GeneID: 100344496
NCBI-ProteinID: XP_002716803
Ensembl: ENSOCUG00000010465
UniProt: G1SZC2
LinkDB
Position
14:complement(127467592..127859183)
AA seq 984 aa
MDCHLSILLLLSASVLHCFGELTPQPPNEVNLLDSKTIQGELGWISYPSHGWEEISGVDE
HYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETF
NLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFY
LAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPP
RMYCSTEGEWLVPIGKCSCNAGYEEGGFSCQACRPGFYKASDGNLKCAKCPPHSSTHEDG
SVNCRCENNYFRADKDPPSMACTRPPSAPRNVISNINETSVILDWSWPLDTGGRKDVTFN
IICKKCGWNVKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAINGVSELSS
PPRQFAAVSITTNQAAPSPVMTIKKERTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQ
ETSYTILRARGTNVTISSLKPDTTYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGENS
QVVMIAISTAVAIILLTVVIYVLIGRFCGYNKSKHGVEEKRLHFGNGHLKLPGLRTYVDP
HTYEDPTQAVHEFAKELDATNISIDKVVGAGEFGEVCSGRLKLPSKKEISVAIKTLKVGY
TEKQRRDFLGEASIMGQFDHPNIIRLEGVVTKSKPVMIVTEYMENGSLDSFLRKHDAQFT
VIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAY
TTRGGKIPIRWTSPEAIAYRKFTSASDVWSYGIVLWEVMSYGERPYWEMSNQDVIKAVDE
GYRLPPPMDCPAALYQLMLDCWQKDRNNRPKFEQIVSILDKLIRNPGSLKIITSAAARPS
NLLLDQSNVDITTFRTTGDWLNGVRTAHCKEIFTGVEYSSCDTIAKISTDDMKKVGVTVV
GPQKKIISSIKVLETQSKNGPVPV
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggattgtcacctctccatcctcctcctgctcagcgcctctgttctccactgcttcggg
gaactgactccgcagcctcccaatgaagtcaatctactggattcaaaaacaattcaaggg
gagctgggttggatctcttatccatcacatgggtgggaagagatcagtggtgttgatgaa
cattacacacccatcaggacttatcaggtgtgcaatgtcatggatcacagtcaaaataac
tggctgaggacaaactgggtccccaggaactcagctcagaagatttacgtggagctcaaa
ttcacattacgggactgcaatagcatcccattggttttgggaacttgcaaggagactttc
aacctgtactacatggagtctgacgatgatcacggggtcaagttccgggagcatcagttt
accaagattgacaccattgccgccgatgaaagtttcactcaaatggaccttggggaccgc
attctgaaactcaacacggagattagagaagtgggtcctgtcaacaagaagggattttac
ttggcttttcaagatgttggtgcttgtgtcgccttggtgtctgtgagagtgtacttcaaa
aagtgcccattcacagtgaagaatctggcgatgtttccagacacagtgcccatggactcc
cagtccctggtggaggtgaggggctcttgtgtcaacaattcgaaggaggaagatcctccc
aggatgtactgtagtacggaaggcgaatggcttgtacccataggcaagtgctcctgcaat
gctggctatgaagaaggaggcttcagctgccaagcttgtcgaccaggcttctacaaggct
tcagacgggaacttgaagtgcgccaagtgcccacctcatagttctactcatgaagatggt
tcagtgaactgcaggtgtgagaataattacttccgagcagacaaagatcctccatccatg
gcttgtacccgacctccatctgcaccaagaaatgttatctctaatataaacgagacctcc
gttatcctggactggagttggcccctggacacaggaggccggaaagatgttaccttcaac
atcatatgtaaaaaatgtgggtggaatgtaaaacagtgtgaaccatgcagcccaaatgtc
cgcttcctccctcgacagtttggtctcaccaacaccactgtgacagtgacagacctcctg
gcacacactaactacacctttgagattgatgccattaatggagtgtcagagctgagctct
ccaccaagacaatttgctgcagtgagcatcacaactaatcaggctgcaccatcacctgtc
atgacaattaagaaagagcgaacatccagaaatagcatctctttatcctggcaagaacct
gaacatcccaatgggatcatattggactacgaggtcaaatattatgaaaagcaggaacaa
gagacaagttataccattttgagggcaagaggcacaaatgttaccatcagtagcctcaag
cctgacactacgtatgttttccaaatccgagcccgaacagcagctggatatgggaccaac
agccgcaagtttgagtttgaaactagcccagactctttttccatctctggtgaaaacagc
caggtggtgatgatcgccatctcaacggcggtagcaattattctcctcactgtcgtcatc
tatgttctgattgggaggttctgtggctacaacaagtcaaagcacggtgtagaggagaag
aggctgcactttgggaatgggcatttaaagctgccgggtctcagaacttacgtggatcca
catacttatgaagacccaacccaagcagtacatgagtttgccaaggaattggatgccacc
aacatatccattgacaaagttgttggagcaggtgaatttggagaggtatgcagtggtcgc
ttaaaactcccttcgaaaaaagagatttcagtggccatcaagaccctgaaagtgggctac
acagaaaagcagaggagggacttcttgggggaagcaagcattatgggacaatttgaccat
cccaatatcattcgactggaaggagttgttactaaaagtaagccagttatgattgtcaca
gaatacatggagaatggttctttggacagtttcttacggaaacatgatgcccagtttaca
gttatccagctggtggggatgctgcgagggatagcatctggcatgaagtacctctcggac
atgggctacgttcaccgagatcttgccgctcggaacatcttaatcaacagcaacttggtc
tgtaaggtttctgattttggactttcacgtgttctggaagatgacccagaagctgcttat
acaacgcggggaggcaagatcccaatccgctggacgtcaccagaagctatagcctaccgc
aaattcacatcagccagcgatgtgtggagttacgggattgttctctgggaggtgatgtct
tatggagagagaccatactgggagatgtccaatcaggacgtaattaaggctgtggatgag
ggctatcgcctaccaccccccatggactgcccagctgccttgtatcagctgatgctggac
tgctggcagaaagacagaaacaacagacccaagtttgagcagattgtcagcatcctggac
aagctcatccggaatcccggcagcctgaagatcatcaccagtgcggcagcaaggccatca
aacctccttctggaccaaagcaatgtcgacatcactaccttccgcacaacaggtgactgg
cttaatggtgtccggacagcacactgcaaggagatcttcacaggcgtggagtacagttct
tgtgacaccatagccaagatttccacagatgacatgaaaaaggttggtgtcaccgtggtt
gggccacagaagaagatcatcagtagcataaaagttctagaaacacaatcaaagaatggt
ccagttccagtgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100344577
Entry
100344577         CDS       T03373                                 
Symbol
EPHA7
Name
(RefSeq) EPH receptor A7
  KO
K05108  EphA7 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100344577 (EPHA7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100344577 (EPHA7)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100344577 (EPHA7)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100344577 (EPHA7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 SAM_1 SAM_2 EphA2_TM Ephrin_rec_like Pur_ac_phosph_N Tissue_fac Interfer-bind DUF4998 ABC1 FtrD-like Haspin_kinase Kdo Pkinase_fungal
Other DBs
NCBI-GeneID: 100344577
NCBI-ProteinID: XP_002714635
Ensembl: ENSOCUG00000000672
LinkDB
Position
12:complement(80430124..80622418)
AA seq 994 aa
MVFQTRYPSWIILCYIWLLRFAHTGEAQAAKEVLLLDSKAQQTELEWISSPPNGWEEISG
LDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCK
ETFNLYYYETDYDTGRNIRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKK
GFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEE
EAENSPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCEPCGRGFYKSSSQDLQCSRCPTHS
FSDKEGSSRCECEDGYYRAPSDPPYVACTRPPSAPQNLIFNINQTTVSLEWSPPADNGGR
NDVTYRILCKRCSWEQGECVPCGSNIGYMPQQTGLEDNYVTVMDLLAHANYTFEVEAVNG
VSDLSRSQRLFAAVSITTGQAAPSQVSGVMKERVLQRSVELSWQEPEHPNGVITEYEIKY
YEKDQRERTYSTVKTKSTSASINNLKPGTVYVFQIRAFTAAGYGNYSPRLDVATLEEATG
KMFEATAVSSEQNPVIIIAVVAVAGTIILVFMVFGFIIGRRHCGYSKADQEGDEELYFHC
TKTYIDPETYEDPNRAVHQFAKELDASCIKIERVIGAGEFGEVCSGRLKLPGKRDVAVAI
KTLKVGYTEKQRRDFLCEASIMGQFDHPNVVHLEGVVTRGKPVMIVIEFMENGALDAFLR
KHDGQFTVIQLVGMLRGIAAGMRYLADMGYVHRDLAARNILVNSNLVCKVSDFGLSRVIE
DDPEAVYTTTGGKIPVRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQD
VIKAIEEGYRLPAPMDCPAGLHQLMLDCWQKERAERPKFEQIVGILDKMIRNPNSLKTPL
GTCSRPISPLLDQNTPDFTTFCSVGEWLQAIKMERYKDNFTAAGYNSLESVARMTIEDVM
SLGITLVGHQKKIMSSIQTMRAQMLHLHGTGIQV
NT seq 2985 nt   +upstreamnt  +downstreamnt
atggtttttcaaactcggtacccttcatggattattttatgctacatctggctgctccgt
tttgcacacacgggggaggcgcaggctgcgaaggaagttctactgctggattctaaagca
caacaaacagaattggaatggatttcttctccacccaatgggtgggaagaaattagtggt
ttggatgagaactataccccaatacgaacataccaggtgtgccaggtcatggagcccaac
caaaacaactggctgcggactaactggatttcaaaaggcaatgcacaaaggatttttgta
gaattgaaatttaccctgagggattgtaacagtcttcctggagtactgggaacttgcaag
gaaacctttaatttgtactattacgaaacagactacgatactggcaggaatataagagaa
aatctttatgtaaaaatagacaccattgctgcagatgaaagttttacccaaggtgacctt
ggtgaaagaaagatgaagcttaacactgaggtgagagagattggacctttgtccaaaaag
ggattctatcttgcctttcaggacgtgggggcttgcatagctttggtttctgtcaaagta
tactacaagaagtgctggtccattattgagaacttagctatctttccagatacagtgact
ggttcagaattttcctccctagtcgaggttcgagggacatgtgtcagcagtgcagaagag
gaggcagaaaactcccccaggatgcactgcagtgcagaaggagaatggttagtgcccatt
ggaaaatgtatctgcaaagcgggctaccaacaaaaaggggacacttgtgaaccttgtggc
cgtgggttctacaaatcttcctcacaagatcttcagtgctctcgttgtccaactcacagt
ttttctgataaagaaggttcctcaagatgtgaatgtgaagatgggtattatagggctcca
tctgacccgccttatgttgcgtgcacaaggcctccatctgcaccacagaacctcattttt
aacatcaaccaaaccacagtaagtttggaatggagtcctcctgcagacaatgggggaaga
aacgatgtcacctatagaattttatgtaaaagatgcagttgggaacaaggtgaatgtgtt
ccctgtgggagtaacattggatacatgccccagcagactggattagaggataactatgtc
acagtcatggacctgctagcccatgctaattatacttttgaagttgaagctgtaaatgga
gtttctgacttaagccgatcccagaggctctttgctgccgtcagtatcaccactggtcaa
gcagctccctcgcaagtgagcggagtaatgaaggagagagtgctgcagcggagtgttgag
ctttcctggcaggaaccagagcatcccaatggagtcatcacggaatatgaaatcaagtat
tacgagaaagatcaaagggaaaggacctattcaacagtaaaaaccaagtccacttctgca
tccatcaacaatctgaaaccagggacagtgtatgttttccagattcgggcttttactgct
gctggctatgggaactacagccccagacttgatgttgctacactagaggaagctacaggt
aaaatgtttgaagctacagctgtctccagtgaacagaatcctgttattataattgctgtg
gttgctgtggcaggaaccatcattctggtgttcatggtttttggattcatcattggaaga
aggcactgtggttacagcaaagctgaccaagaaggagatgaagaactttactttcattgc
accaaaacctacattgaccctgaaacctatgaggacccaaatagagctgtccatcaattc
gccaaggagctagatgcctcctgtattaaaattgagcgtgtgattggtgcaggagaattt
ggagaagtctgcagtgggcgtttgaaacttccagggaaaagagatgttgctgtggccata
aaaaccctgaaagttggttatacagaaaaacaaaggagagactttctgtgtgaagcaagc
atcatgggccagtttgatcacccaaatgttgtccatttggaaggggttgttacaagaggg
aaaccagtcatgattgtaatagaattcatggaaaatggagccctagatgcatttctcagg
aaacatgatggtcaatttacagtaattcagttagtaggaatgctaagaggaattgctgct
ggaatgagatatttggctgatatgggatatgttcacagggaccttgcagctcgtaatatt
cttgtcaacagcaatcttgtttgtaaagtgtcagattttggcctgtcccgggttatagag
gatgatccagaagctgtctatacaactactggtggaaaaattccagtaagatggacagca
cctgaagccatccaatataggaaattcacatcagccagtgatgtatggagctatggaata
gtcatgtgggaagttatgtcttatggagaacgaccttattgggacatgtcaaatcaagat
gttataaaagcaatagaagaaggttatcgcttaccagcacccatggactgcccagctggc
cttcaccagctaatgctggattgttggcagaaggagcgtgcagaaaggccaaagtttgag
cagatagtcggaattctagacaaaatgattcgaaatccaaatagtctgaaaacacccctg
ggaacctgtagcaggccaataagccctcttctggatcaaaatactcctgacttcactacc
ttttgttcagttggagaatggctacaagctattaagatggaaagatataaagataacttc
acagcagctggctacaactcccttgaatcggtggccaggatgacaattgaggatgtgatg
agtttagggatcacactcgttggccatcaaaagaaaatcatgagcagcattcagactatg
agggcacaaatgctgcatttacatggaactggcattcaagtgtga

KEGG   Oryctolagus cuniculus (rabbit): 100345523
Entry
100345523         CDS       T03373                                 
Symbol
EPHA5
Name
(RefSeq) EPH receptor A5
  KO
K05106  Eph receptor A5 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100345523 (EPHA5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100345523 (EPHA5)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100345523 (EPHA5)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100345523 (EPHA5)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N HNH_5 ABC1 Kdo DUF4998 Haspin_kinase Pkinase_fungal
Other DBs
NCBI-GeneID: 100345523
NCBI-ProteinID: XP_002717197
Ensembl: ENSOCUG00000017595
LinkDB
Position
15:83966369..84333984
AA seq 1038 aa
MRGSGPRAARSQRAPGGGGGDTSSPSASLAGCCSTPRMAPLWTCLLLCAALRTLLASPSN
EVNLLDSRTVMGDLGWIAFPKNGWLEIGEVDENYAPIHTYQVCKVMEQNQNNWLLTSWIS
NEGASRIFIELKFTLRDCNSLPGGLGTCKETFNMYYFESDDENGRSIKENQYIKIDTIAA
DESFTELDLGDRVMKLNTEVRDVGPLTRKGFYLAFQDVGACIALVSVRVYYKKCPSVVRH
LAVFPDTITGADSSQLLEVSGSCVNHSVTDEPPKMHCSAEGEWLVPIGKCMCKAGYEEKN
GTCQVCRPGFFKASPHSQSCSKCPPHSYTHEEASTSCVCEKDYFRRESDPPTMACTRPPS
APRNAISNVNETSVFLEWIPPADTGGRKDVSYYIACKKCNSHAGVCEECGRHVRYLPQQI
GLKNTSVMMVDLLAHTNYTFEIEAVNGVSDLSPGARQFVSVNVTTNQAAPSPVTNVKKGK
IAKNSISLSWQEPDRPNGIILEYEIKYFEKDQETSYTIIKSKETTITAEGLKPASVYVFQ
IRARTAAGYGVFSRRFEFETIPVFAASSDQSQIPIIAVSVTVGVILLAVVIGFLLSGSCC
ECGCGRASSLCAVAHPSLIWRCGYSKAKQDPEEEKMHFHNGHIKLPGVRTYIDPHTYEDP
NQAVHEFAKEIEASCITIERVIGAGEFGEVCSGRLKLPGKRELPVAIKTLKVGYTEKQRR
DFLGEASIMGQFDHPNIIHLEGVVTKSKPVMIVTEYMENGSLDTFLKKNDGQFTVIQLVG
MLRGIAAGVKYLSDMGYVHRDLAARNILINSNLVCKVSDFGLSRVLEDDPEAAYTTRGGK
IPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVVSYGERPYWEMTNQDVIKAVEEGYRLPS
PMDCPAALYQLMLDCWQKDRNSRPKFDEIVNMLDKLIRNPSSLKTLVNASSRVSNLLAEH
VPLGSGAYRSVGEWLEAIKMGRYTEIFMENGYSSMDAVAQVTLEDLRRLGVTLVGHQKKI
MNSLQEMKVQLVTGMVPL
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgcggggctcggggccccgcgccgcgagaagccagcgggcgccgggcggcggcggcggc
gacacctccagcccctctgcgtccctggccggctgctgctccacacctcgcatggctccc
ctctggacgtgccttctcctgtgcgccgcgctccggaccctcctggccagccctagcaac
gaagtgaatttgttggattcacgcacggtcatgggagacctaggatggattgcttttccc
aaaaatggctggctagagattggtgaagtggatgaaaactatgcccctatccacacatac
caagtatgcaaagttatggaacagaatcagaacaactggcttttgaccagttggatctcc
aatgaaggtgcttccagaatcttcatagagctcaagttcacgttgcgggactgcaacagc
cttcctggaggactgggaacctgcaaagaaactttcaacatgtactactttgagtctgat
gatgaaaacgggagaagcatcaaggaaaaccagtacatcaaaatcgataccattgctgct
gacgagagctttacagaactggacctcggtgaccgtgtcatgaagctgaatacagaggtc
agagatgtggggcctctgaccagaaagggcttctatcttgctttccaagacgttggcgcc
tgcatcgctctggtttctgtgcgtgtgtactataagaaatgcccttccgtggtgcgacac
ttggctgtcttccccgacaccatcaccggagcagattcttcacagttgctggaagtgtca
ggctcctgtgtcaaccattctgtgacagatgagcctcccaaaatgcactgcagcgcggag
ggggagtggctggtgcccatcgggaaatgcatgtgcaaggcaggatatgaggagaaaaat
ggcacctgccaagtgtgcagacctgggttcttcaaagcctcacctcacagccagagctgc
agcaaatgtccacctcacagttacacccatgaggaagcatccacctcttgtgtctgtgaa
aaggattatttcaggagggagtctgatccacccacaatggcatgcacaagacccccctca
gcccctcggaatgccatctcaaatgttaatgagactagtgtctttctggaatggattccg
cctgctgacactggtggaaggaaagatgtgtcctattatattgcatgcaagaagtgcaac
tcccatgcaggtgtgtgtgaggagtgtggccgtcatgtcaggtacctcccccagcaaatc
ggcctgaaaaacacctctgtcatgatggtggatctgctcgctcacacaaactataccttt
gagattgaggcagtgaacggagtgtccgacttgagcccaggagcccggcagtttgtgtct
gtaaatgtaaccacaaatcaagcagccccctcgccagtcaccaacgtgaagaaggggaaa
attgccaaaaacagcatctctctgtcttggcaagagccagatcgccccaatggaatcatc
ctagaatatgaaatcaaatattttgaaaaggaccaagagaccagctacacaattatcaaa
tctaaagagacaaccattaccgcagagggcctgaaaccagcgtcagtctatgtcttccaa
attcgagcacgtacagcagcaggctatggggtcttcagtcgaagattcgagtttgaaacc
atcccagtgtttgcagcatccagcgatcaaagccagattcctataattgctgtgtccgtg
acagtgggagtcattttgttggcagtggttatcggcttcctcctcagtggaagttgctgc
gaatgtggctgtggaagggcttcttccctgtgcgctgttgcccatccaagcctaatatgg
cggtgtggctacagcaaagcaaagcaagatccggaagaggaaaagatgcattttcataat
gggcacattaaactgcctggagtaagaacttacattgatccacatacctatgaggatccc
aaccaagctgtacatgaatttgccaaggagatagaagcttcatgtattaccatcgaaaga
gttattggagcaggtgaatttggcgaggtgtgtagtggacgtctgaagctgccaggtaaa
agagaattacctgtggctatcaaaaccctgaaggtgggctacactgagaagcagcgcaga
gatttccttggtgaagcaagtatcatggggcagttcgatcatcctaacatcatccacttg
gaaggtgttgtgaccaaaagtaaacccgtgatgattgtgacagagtacatggagaatggc
tctctcgatacatttttaaagaagaacgatgggcagttcacagtgattcagctcgtcggc
atgctgagaggcatcgctgcaggagtgaagtacctgtctgacatgggctacgtgcaccga
gaccttgctgccaggaacatcttaatcaacagcaaccttgtgtgcaaagtgtctgacttt
ggactttccagggtactggaagatgatcctgaggcagcctacaccacaaggggaggcaaa
attccaatccgatggactgccccagaagcaatcgctttccgaaagttcacctccgccagt
gatgtctggagctatggaattgtaatgtgggaagttgtgtcttacggagagagaccctac
tgggagatgaccaatcaagatgtgattaaagcagtagaggaaggctaccgtctgccaagc
cccatggactgccctgctgctctctatcaactaatgctggactgctggcagaaggaccga
aatagtaggcccaagtttgatgaaatagtcaacatgctggacaagctgatacgcaaccca
agtagtctgaagacattggttaatgcatcaagcagagtatctaatttattggcagaacat
gtcccactaggatcgggggcctacagatcagtaggtgaatggctagaagcaatcaagatg
ggccggtatacagagattttcatggaaaatggatacagttctatggacgctgtggctcag
gtgaccttggaggatttgaggcggcttggagtgactcttgtcggtcaccagaagaagatc
atgaacagccttcaagaaatgaaggtgcagctggtaaccgggatggtgccgttgtaa

KEGG   Oryctolagus cuniculus (rabbit): 100357064
Entry
100357064         CDS       T03373                                 
Symbol
EPHA4
Name
(RefSeq) EPH receptor A4
  KO
K05105  Eph receptor A4 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100357064 (EPHA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100357064 (EPHA4)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100357064 (EPHA4)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100357064 (EPHA4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_2 SAM_1 Ephrin_rec_like fn3_2 Pur_ac_phosph_N ABC1 CD34_antigen Kdo Haspin_kinase DUF6479 DUF6377
Other DBs
NCBI-GeneID: 100357064
NCBI-ProteinID: XP_002712542
Ensembl: ENSOCUG00000006723
UniProt: G1SRK6
LinkDB
Position
7:complement(162722604..162881129)
AA seq 986 aa
MAGIFYFVFFSFLFGVCDAVTGSRVYPANEVTLLDSRSVQGELGWIASPLEGGWEEVSIM
DEKNTPIRTYQVCNVMEPSQNNWLRTDWITREGAQRVYIEIKFTLRDCNSLPGVMGTCKE
TFNLYYYESDNDKERFIRESQFAKIDTIAADESFTQVDIGDRIMKLNTEIRDVGPLSRKG
FYLAFQDVGACIALVSVRVFYKKCPLTVRNLAQFPDTITGADTSSLVEVRGSCVNNSEEK
DVPKMYCGADGEWLVPIGNCLCNAGHEEQSGECQACKIGYYKALSTDATCAKCPPHSYSV
WEGATSCTCDRGFFRADNDAASMPCTRPPSAPLNLISNVNETSVNLEWSSPQNTGGRQDI
SYNVVCKKCGAGDPSKCRPCGSGVHYTPQQNGLKSTKVSITDLLAHTNYTFEIWAVNGVS
KYNPSPDQSVSVTVTTNQAAPSSIALVQAKEVTRYSVALAWLEPDRPNGVILEYEVKYYE
KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRII
GDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPF
TYEDPNQAVREFAKEIDASCIKIEKVIGVGEFGEVCSGRLKVPGKREICVAIKTLKAGYT
DKQRRDFLSEASIMGQFDHPNIIHLEGVVTKCKPVMIITEYMENGSLDAFLRKNDGRFTV
IQLVGMLRGIGSGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGMSRVLEDDPEAAYT
TRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVIKAIEEG
YRLPPPMDCPIALHQLMLDCWQKERSDRPKFGQIVNMLDKLIRNPNSLKRTGTESSRPNT
ALLDPSSPEFSAVVSVGDWLQAIKMDRYKDNFTAAGYTTLEAVVHMNQDDLSRIGITAIT
HQNKILSSVQAMRTQMQQMHGRMVPV
NT seq 2961 nt   +upstreamnt  +downstreamnt
atggctgggattttctatttcgtcttcttttcgtttctctttggggtctgcgacgctgtc
accggttccagggtgtaccccgcgaatgaagttactctattggattccagatccgttcag
ggagaacttgggtggatagcaagtcctttggaaggagggtgggaggaagtgagtattatg
gatgaaaaaaatacgccaatccgaacctaccaagtgtgcaacgtgatggaaccgagccag
aacaactggctacgaactgattggatcacccgagaaggggctcagagggtgtatattgag
atcaagttcaccttgagggactgcaatagtcttccgggcgtcatggggacttgcaaggag
acctttaacctgtactactacgaatcagacaatgacaaagagcgcttcattagagagagc
cagtttgccaagatcgacaccattgctgctgacgagagcttcacccaagtggacattggt
gatcgaatcatgaagctgaatacggagatccgggatgtagggccgctgagcagaaaagga
ttttacctggcttttcaggatgtgggggcctgcatagccctagtgtctgtccgtgtgttc
tataagaagtgtccactcaccgttcgcaatctggcccagtttccagataccatcacaggg
gctgatacctcatctctggtggaagttcgaggctcctgcgtcaacaactcagaagagaag
gatgtgccaaaaatgtactgtggggcagatggtgagtggctggtacccattggcaactgt
ttgtgcaacgctgggcatgaagagcagagtggagaatgccaagcttgcaaaatcggatac
tacaaggctctctccacggatgccacctgtgccaagtgtccaccccacagctactctgtc
tgggaaggcgccacctcgtgcacctgtgatcgaggctttttcagagccgacaatgatgct
gcctccatgccctgcacccgcccaccatccgctcccctcaacctcatttcaaacgtgaac
gagacatcagtgaacttggaatggagcagtcctcagaatacaggtggtcgtcaggatatc
tcctacaatgtggtttgcaagaaatgtggagctggtgaccccagcaagtgccgcccctgt
ggaagtggggtccactatacaccacagcagaacggcctgaagagcaccaaggtctccatc
actgaccttctagctcacaccaattacacgtttgagatctgggctgtgaatggagtttcc
aagtataaccctagccctgaccagtccgtttctgtcactgtgacaaccaatcaagcagct
ccatcatccattgccttggtccaggctaaagaagtcacaagatatagtgtggcattggct
tggttggaaccagatcgacccaatggggttatcttggaatatgaagtcaaatactatgag
aaggatcaaaatgagcgaagctatcgtatagttcggacagctgccaggaacacggatatc
aaaggcctgaaccctctcacttcctatgttttccatgtgagagccaggacagcagctggc
tatggagacttcagtgagcccttggaggtgacgaccaacacagtgccttcccggatcatc
ggcgatggggccaactccacagtccttctggtctctgtctcaggcagtgtggtgctggtg
gtcatcctcattgcagcttttgtcatcagcaggagacggagtaaatacagtaaagcaaaa
caagaagcagatgaagagaaacatttaaatcaaggtgttagaacttatgtggatcccttt
acatatgaagatcccaaccaagcagttcgagaattcgccaaagaaatcgatgcatcctgt
attaagattgaaaaagtcataggtgttggtgaatttggcgaagtgtgcagtgggcgtctc
aaagtgcctggcaagagagagatctgtgtggccatcaagactctgaaagcgggttataca
gacaaacagaggagagacttcctcagtgaggccagcatcatgggacagtttgaccacccg
aacataattcacttggaaggtgtcgtcaccaaatgtaaaccagtaatgatcataacagaa
tatatggagaatggctctttggatgcattcctcaggaagaatgatggtagatttacagtc
attcagctggtgggcatgcttcgtggcatcgggtccgggatgaagtacttatctgacatg
agctatgtgcatcgtgatctggccgcccggaacatcctggtaaatagcaacttagtctgc
aaagtgtctgatttcggcatgtcacgcgtgcttgaggatgatccggaagcagcgtacacc
accaggggtggcaagattcctatccggtggaccgcgccagaggcaattgcctatcgtaaa
ttcacatcagccagtgatgtatggagctatggaatcgttatgtgggaagtgatgtcgtat
ggagaaagaccttactgggatatgtccaatcaagatgtgattaaagccattgaggaaggc
tatcggctaccccctccgatggactgccccattgcactgcaccagctgatgctggactgc
tggcagaaggagagaagcgacaggcctaaatttgggcagattgtcaacatgttggacaaa
ctcatccgcaatcccaacagcttgaagaggacagggacggagagttccagaccaaacact
gccttgttggatccaagctcccctgaattctctgccgtggtatcagtgggcgattggctg
caggccattaaaatggaccggtataaggataacttcacagctgctggttataccacacta
gaggctgtggtgcacatgaaccaggatgacctgtcaagaattggcatcacagctatcacc
caccagaataagatcttgagcagtgtccaggcgatgcggacccaaatgcagcagatgcat
ggcagaatggttcctgtctga

KEGG   Oryctolagus cuniculus (rabbit): 100357849
Entry
100357849         CDS       T03373                                 
Symbol
EPHA6
Name
(RefSeq) EPH receptor A6
  KO
K05107  Eph receptor A6 [EC:2.7.10.1]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100357849 (EPHA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ocu01001]
    100357849 (EPHA6)
Enzymes [BR:ocu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100357849 (EPHA6)
Protein kinases [BR:ocu01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   100357849 (EPHA6)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N fn3_2 Tissue_fac Kdo ABC1 Haspin_kinase UPF0542
Other DBs
NCBI-GeneID: 100357849
NCBI-ProteinID: XP_008265300
UniProt: U3KN97
LinkDB
Position
14:complement(122845489..123861583)
AA seq 1130 aa
MQFRSPPAARSSPALQAASSSQAAALAPGQPGPSCPGLGASHGGRPGTPPAGRVEEEAEE
EEEDVDQDPYATYNTWPRRCPFFLRGRRSASGRAMGGCEVREFLWQFGFFLPLLTAWPGD
CSHVSNNQVVLLDTTTVLGELGWKTYPLNGWDAITEMDEHNRPIHTYQVCNVMEPNQNNW
LRTNWISRDAAQKIYVEMKFTLRDCNSIPWVLGTCKETFNLYYMESDESHGIKFKPSQYT
KIDTIAADESFTQMDLGDRILKLNTEIREVGPIERKGFYLAFQDIGACIALVSVRVFYKK
CPFTVRNLAMFPDTIPRVDSSSLVEVRGSCVKSAEERDTPKLYCGADGDWLVPLGRCICS
TGYEEIEGSCHACRPGFYKAFAGNAKCSKCPPHSLTYKEATSVCQCEKGYFRAEKDPPSM
ACTRPPSAPRNVVFNINETALILEWSPPSDTGGRKDLTYSIICKKCGLDTSQCEDCGGGL
RFIPRHTGLINNSVIVLDFVSHVNYTFEIEAMNGVSELSFSPKPFTAITVTTDQDAPSLI
GMVRKDWASQNSIALSWQAPAFSNGAILDYEIKYYEKEHEQLTYSSTRSKAPSVIITGLK
PATKYIFHIRVRTATGYSGYSQKFEFETGDETSDMAAEQGQILVIATAAVGGFTLLVILT
LFFLITGRCQWYIKAKMKSEEKRRNQLQNGHLRFPGVKTYIDPDTYEDPSLAVHEFAKEI
DPSRIRIERVIGAGEFGEVCSGRLKTPGKREIPVAIKTLKGGHMDRQRRDFLREASIMGQ
FDHPNIIRLEGVVTKRSFPAIGVETFCPSFLRAGFLNSIQAPHPVPGGGSLPPRIPAGRP
VMIVVEYMENGSLDSFLRKHDGHFTVIQLVGMLRGIASGMKYLSDMGYVHRDLAARNILV
NSNLVCKVSDFGLSRVLEDDPEAAYTTTGGKIPIRWTAPEAIAYRKFSSASDAWSYGIVM
WEVMSYGERPYWEMSNQDVILSIEEGYRLPAPMGCPASLHQLMLHCWQKERNHRPKFTDI
VSFLDKLIRNPSALHTLVEDILVMPESPGEVSEYPLFVTVGDWLDSIKMGQYKNNFMAAG
FTTFDLISRMSIDDIRRIGVILIGHQRRIVSSIQTLRLHMMHIQEKGFHV
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgcaattccgctcgcctccagccgccaggagctccccggcgctgcaggcagcgtcgtcc
tcccaagcagctgcacttgcacctgggcagcctggaccctcgtgccctgggctcggggcc
tcgcacggggggcgccccgggacaccccctgcgggccgggtggaggaggaggcggaggag
gaggaagaagacgtggaccaggacccctacgctacctacaacacctggccgcgccgctgc
cccttctttttgagggggaggaggagcgcgtcggggagagccatggggggctgcgaagtc
cgggaatttctttggcaatttggtttcttcttgcctttgctgacagcttggccgggcgac
tgcagtcatgtctccaacaaccaagttgtgttacttgatacaacaactgtactgggagaa
ctagggtggaaaacatatccattaaatgggtgggatgccatcactgaaatggatgaacac
aatagacccattcacacataccaagtatgtaatgtcatggaaccaaatcaaaacaactgg
cttcgcacaaactggatctcccgtgatgcagcccagaaaatttacgtggaaatgaagttc
acactgagggattgtaacagcatcccatgggtcttagggacttgcaaagaaacatttaat
ctgtattatatggaatcagatgagtcccatggaattaaattcaagccaagccagtataca
aagattgacacaattgctgctgatgagagttttacccagatggatttgggtgatcgcatc
ctgaaactcaacactgaaattcgtgaggtggggcctatagaaaggaaaggattttatctg
gcttttcaagacattggtgcatgtattgccctggtctcagtccgcgttttttataaaaaa
tgccccttcactgttagaaacttggccatgtttcctgacaccattccaagggttgattct
tcgtcattggttgaagtacgaggctcttgtgtgaagagtgctgaagagcgtgacactcct
aaactctattgtggagctgatggagattggctagttcctctcggaaggtgtatctgcagt
acaggatatgaagaaattgagggctcttgccatgcttgcagaccaggattctataaagca
tttgccggcaacgcaaagtgttctaaatgccctccacacagtttaacctacaaggaagca
acttctgtgtgtcagtgtgagaagggttatttccgagctgaaaaagacccaccttccatg
gcatgtaccaggccaccttcagctcctaggaatgtggtttttaacatcaatgaaacagcc
cttattttggaatggagcccaccaagtgacacaggagggagaaaagatctcacatacagt
ataatctgtaagaaatgtggcttagacaccagccagtgtgaggactgtggtggaggactc
cgcttcatcccaagacacactggcctgatcaacaattccgtgatcgtacttgactttgtg
tctcacgtgaattacacctttgaaatagaagccatgaatggagtttccgagttgagtttt
tctcccaagccgttcacagctattacagtgaccacggatcaagatgcaccttctctgata
ggcatggtaaggaaggactgggcttcccagaatagcattgccctatcatggcaagctcct
gctttttccaatggagccattcttgactacgagatcaagtactatgagaaagagcatgag
cagctcacctattcctccacgagatccaaggcccccagtgtcatcatcacaggtctcaag
ccagccaccaagtacatatttcatatccgagtgaggactgcaacaggatacagtggctac
agtcagaagtttgaatttgaaacaggagatgaaacttctgacatggcagcagaacaaggg
cagattctcgtgatagccacagcagctgttgggggattcactcttctggtcatcctcact
ttgttcttcttaataactggaaggtgccaatggtacataaaagccaaaatgaagtcagaa
gagaagagaagaaaccagctacagaatgggcatttacgcttcccaggagttaaaacttat
atcgaccctgatacatatgaagacccatccctagcagttcatgaatttgcaaaagagatt
gatccttcaagaattcgcatcgagagagtcattggagcaggtgaatttggagaagtatgt
agtgggcgtttgaagacaccaggtaaaagagagatcccagttgccatcaaaacattgaaa
ggcggccacatggatcggcagagaagagattttctaagagaagctagtatcatgggtcag
tttgaccatccaaatatcatccgcctagaaggtgtggtcacaaaaagatccttcccagcc
attggggtggagacgttttgccccagcttcctgagggcagggtttttaaatagcatccag
gccccgcatccagtgccagggggaggatctctgccccccaggattcctgctggcagacca
gtaatgattgtggtggaatacatggagaatggatccctagactcctttttaaggaaacat
gatggccactttacagtcatccagctggtcgggatgctccgaggcattgcgtcaggcatg
aaatacctttctgacatgggttacgtgcatcgagacctagcagcaaggaatatattggtc
aacagcaacttagtgtgcaaagtttctgattttggtctctcccgggtgctggaagatgac
ccagaagctgcttatacaacaactggtgggaaaatccctatacggtggacagccccagaa
gctatagcctacagaaaattctcctcggcgagtgatgcctggagctacggcattgtcatg
tgggaggtcatgtcctatggagagagaccctactgggaaatgtctaaccaagacgtcatt
ctgtccattgaagaaggttacagacttccagctcccatgggctgtccagcttctctacac
caactgatgctccactgctggcagaaggagagaaaccacagaccaaaatttactgacatt
gtcagcttccttgacaaactgatccgcaatcccagtgcccttcacaccctggtggaggac
atccttgtaatgccagagtcccctggtgaagtttccgaatatcctttatttgttacagtc
ggtgactggctggattctataaagatgggacaatataaaaataacttcatggcagcagga
tttacaacttttgatctgatttcaagaatgagcattgatgacattaggagaattggagtc
atactcattggacaccagagacgaatagtcagcagtatacagactttacgtttacacatg
atgcacatacaggagaaaggatttcatgtatga

DBGET integrated database retrieval system