KEGG   Oryctolagus cuniculus (rabbit): 100338113
Entry
100338113         CDS       T03373                                 
Name
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100338113
   04151 PI3K-Akt signaling pathway
    100338113
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100338113
   04061 Viral protein interaction with cytokine and cytokine receptor
    100338113
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100338113
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100338113
   04658 Th1 and Th2 cell differentiation
    100338113
   04659 Th17 cell differentiation
    100338113
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338113
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100338113
   05162 Measles
    100338113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100338113
   04090 CD molecules [BR:ocu04090]
    100338113
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   100338113
CD molecules [BR:ocu04090]
 Proteins
  100338113
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100338113
NCBI-ProteinID: XP_008249720
Ensembl: ENSOCUG00000026402
UniProt: G1U4W6
LinkDB
Position
Un
AA seq 270 aa
MEPRLLLWGLVTFIMVPGFRTDFCDDPPQLSKATFRALAYKIGTMLTCDCEAGFRRVKYG
SSYMLCTGNSSHSFWDNRCQCTSNSLRNPENVTTQPEEQTEGKPTEMQSQMEPEDHVDLP
GHCKEPPPWEHEAKKRIYHFVVGQTVHYQCVQGFRALQRHPAVSVCKMACEKTSWTLPLL
TCAEESQHHQFPGEEEPQASMDAPPESKTSCPVTTTDFQKHTEVATTMETFLFTEEYQIA
VAGCVFLLISVLLLSALSWRRKWKKSRRTI
NT seq 813 nt   +upstreamnt  +downstreamnt
atggagccacgcttgctgctctggggattagtcacgttcatcatggtgcctggcttcagg
acagacttctgtgacgatccaccacagctcagcaaagccaccttcagggccctcgcctac
aagatcggcaccatgctaacctgtgactgcgaggctggcttccgccgagttaaatacggg
tcatcctacatgctttgtacaggaaactccagccactctttctgggacaacagatgtcaa
tgcacaagcaattctcttaggaacccagaaaacgttacaactcaacctgaagaacagaca
gaaggaaaacccacagaaatgcaaagtcaaatggagcctgaggaccacgtggaccttcca
ggtcactgcaaggagcctccaccttgggaacatgaagctaagaagagaatttatcatttt
gtcgtggggcagacagttcactaccagtgcgtccaaggattcagggccctccagaggcat
cctgctgtgagtgtctgcaaaatggcctgtgaaaaaacaagctggaccctgcccctgctc
acctgtgcagaggaaagccagcaccatcaatttccaggtgaagaagagcctcaagcaagc
atggatgcccctcctgagagcaagacttcctgccctgtcaccaccacagattttcagaaa
catacagaagtggctaccaccatggagacgttcctattcacagaggagtatcagatagca
gtggccggctgtgtattcctgctcatcagtgtcctccttctgagcgcactcagctggcgg
cggaaatggaagaagagtagaagaacaatctag

KEGG   Oryctolagus cuniculus (rabbit): 100358489
Entry
100358489         CDS       T03373                                 
Name
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04640  Hematopoietic cell lineage
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100358489
   04151 PI3K-Akt signaling pathway
    100358489
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358489
   04061 Viral protein interaction with cytokine and cytokine receptor
    100358489
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358489
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100358489
   04658 Th1 and Th2 cell differentiation
    100358489
   04659 Th17 cell differentiation
    100358489
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100358489
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100358489
   05162 Measles
    100358489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100358489
   04090 CD molecules [BR:ocu04090]
    100358489
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   100358489
CD molecules [BR:ocu04090]
 Proteins
  100358489
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 100358489
NCBI-ProteinID: XP_002723296
LinkDB
Position
Un
AA seq 292 aa
ENVARIQIHFRNEDICDYVAPRRDPYLCDWDFPNSQHASLSFADFCDDPPQLSKATFRAL
AYKIGTMLTCDCEAGFRRVKYGSSYMLCTGNSSHSFWDNKCQCTSNSLRNPENITTQPEE
QTKGKTTEMQSQMEPEDHVDLPGHCKEPPPWEHEAKKRIYHFVVGQTVHYQCVQGFRALQ
RHPAVSVCKMACEKTSWTLPLLTCAEESQHHQFPGEEEPQASMDAPPESKISCPVTTTDF
QKHTEVATTVETFLFTEEYQIAVAGCVFLLISVLLLSALSWRRKWKKSRRTI
NT seq 879 nt   +upstreamnt  +downstreamnt
gaaaatgtagcgcgtatacaaattcactttagaaatgaagacatatgtgattatgttgct
ccgcgacgagacccgtacctgtgtgactgggacttcccaaactcccaacatgcctctctt
tccttcgcagacttctgtgacgatccgccacagctcagcaaagccaccttcagggccctc
gcctacaagatcggcaccatgctaacctgtgactgcgaggctggcttccgccgagttaaa
tacgggtcatcctacatgctttgtacaggaaactccagccactctttctgggacaacaaa
tgtcaatgcacaagcaattctcttaggaacccagaaaacattacaactcaacctgaagaa
cagacaaaaggaaaaaccacagaaatgcaaagtcaaatggagcctgaggaccacgtggac
cttccaggtcactgcaaggagcctccaccttgggaacatgaagctaagaagagaatttat
cattttgtcgtggggcagacagttcactaccagtgcgtccaaggattcagggctctccag
aggcatcccgctgtgagtgtctgcaaaatggcctgtgaaaaaacaagctggaccctgccc
ctgctcacctgtgcagaggaaagccagcaccatcaatttccaggtgaagaagagcctcaa
gcaagcatggatgcccctcctgagagcaagatttcctgccctgtcaccaccacagatttt
cagaaacatacagaagtggctaccaccgtggagacgttcctattcacagaggagtatcag
atagcagtggccggctgtgtattcctgctcatcagtgtcctccttctgagcgcgctcagc
tggcggcggaaatggaagaagagtagaagaacaatctag

KEGG   Oryctolagus cuniculus (rabbit): 103351862
Entry
103351862         CDS       T03373                                 
Symbol
IL2RG
Name
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04144  Endocytosis
ocu04151  PI3K-Akt signaling pathway
ocu04630  JAK-STAT signaling pathway
ocu04658  Th1 and Th2 cell differentiation
ocu04659  Th17 cell differentiation
ocu05162  Measles
ocu05166  Human T-cell leukemia virus 1 infection
ocu05200  Pathways in cancer
ocu05321  Inflammatory bowel disease
ocu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103351862 (IL2RG)
   04151 PI3K-Akt signaling pathway
    103351862 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103351862 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103351862 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103351862 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    103351862 (IL2RG)
   04659 Th17 cell differentiation
    103351862 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103351862 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103351862 (IL2RG)
   05162 Measles
    103351862 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease
    103351862 (IL2RG)
   05340 Primary immunodeficiency
    103351862 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    103351862 (IL2RG)
   04090 CD molecules [BR:ocu04090]
    103351862 (IL2RG)
Cytokine receptors [BR:ocu04050]
 Interleukin receptor families
  IL2 receptor family
   103351862 (IL2RG)
CD molecules [BR:ocu04090]
 Proteins
  103351862 (IL2RG)
SSDB
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 LIFR_N
Other DBs
NCBI-GeneID: 103351862
NCBI-ProteinID: XP_008270982
Ensembl: ENSOCUG00000025850
LinkDB
Position
X:complement(49578281..49580934)
AA seq 368 aa
MLKPPLPLRSLLFLQLPLLGVGLNQRILTPSENEDTTDSFLTSLSPGSLSVSTLPLPEVQ
CFVYNVEYMNCTWNSSSESQPTNLTLHYRYENSDNYKFQECGYYIFSEEITSGCWLPKEK
ISLYQTFVVQLQDPREPRRQTTRKLKLQNLVIPWAPENLTLLNLSESQLELSWTNRYLNH
CLEHLVQYRSNWDRSWTEQPVHHRQSFSLPSVDGQKLYTFRVRSRFNPLCGSAQHWSEWS
HPIHWGSKTSKENPSPFVLEAVLIPIVSMGLIVGLICVYCWLERTMPQIPTLKNLEDLVT
EYHGNFSAWSGVSKGLAESLQPDYSERLCHVSEIPPKGGALGEGPGGSPCSQHSPYWAPP
CYTLKPET
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgttgaagccgccattgccactcagatcccttttgttcctgcagctgcctctgctgggg
gtggggctgaaccagaggatcctcacacccagtgagaatgaagacacaactgattccttc
ctgacctctctgtcccctgggtccctcagtgtttccaccctgcccctcccagaggttcag
tgttttgtgtacaatgtcgagtacatgaattgcacttggaacagcagctctgagtcccag
cctaccaacctgactctgcactatcggtatgagaactccgacaattacaaattccaagag
tgtggctactatatattctccgaagagatcacttcaggctgttggttgccgaaagagaag
atctctctctaccaaacatttgttgtccagctccaggacccgcgggagcccaggaggcag
accacgaggaagcttaaactgcagaatctggtgatcccctgggctccagagaatctaaca
cttctcaacctgagtgaatctcagctggaactgagctggacaaacagatacttgaaccat
tgtttggagcacctggtgcagtaccggagtaactgggatcgcagctggactgaacagccc
gtgcatcacagacaaagcttctcccttcctagcgtggatgggcagaaactctacacgttc
cgagtccggagccgttttaaccctttgtgtgggagtgctcagcattggagtgaatggagc
cacccgatccactgggggagcaaaacttcaaaggagaatccttcaccgtttgttttggaa
gctgtgcttatccccatcgtctccatgggattgattgttggcctcatctgtgtgtattgc
tggctggaacggacgatgccccagattcctaccctgaagaatctagaggatctggttact
gaataccacgggaacttttcggcttggagtggtgtatctaagggactggccgagagtctg
cagccagactacagtgaacggctctgccacgtcagtgagatccccccaaaaggaggagcc
ctaggagaggggcctgggggctccccctgcagccagcatagcccctactgggcccctcca
tgttacaccctgaagcctgaaacctaa

DBGET integrated database retrieval system