KEGG   Oryctolagus cuniculus (rabbit): 100338152
Entry
100338152         CDS       T03373                                 
Symbol
VPS4B
Name
(RefSeq) vacuolar protein sorting 4 homolog B
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03250  Viral life cycle - HIV-1
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    100338152 (VPS4B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100338152 (VPS4B)
  09143 Cell growth and death
   04217 Necroptosis
    100338152 (VPS4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338152 (VPS4B)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100338152 (VPS4B)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100338152 (VPS4B)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100338152 (VPS4B)
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 AAA_16 TIP49 RuvB_N AAA_22 AAA_5 IstB_IS21 AAA_2 AAA_14 AAA_18 DUF815 AAA_33 RNA_helicase AAA_17 AAA_24 PhoH AAA_7 Mg_chelatase NACHT DUF5906 Sigma54_activat bpMoxR TPR_1 MCM TPR_2
Other DBs
NCBI-GeneID: 100338152
NCBI-ProteinID: XP_008259663
Ensembl: ENSOCUG00000007150
UniProt: A0A5F9CSY2
LinkDB
Position
9:complement(103629577..103668300)
AA seq 444 aa
MSSSSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRA
KCTEYLDRAEKLKEYLKQKEKKPQKPVKEAQPSSADEKGNDSDGEGESDDPEKKKLQNQL
QGAIVIERPNVKWSDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGK
SYLAKAVATEANNSTFFSISSSDLVSKWLGESEKLVKNLFQLARENKPSIIFIDEIDSLC
GSRSENESEAARRIKTEFLVQMQGVGVDNDGILVLGATNIPWVLDSAIRRRFEKRIYIPL
PEAHARAAMFKLHLGTTQNSLTETDFRDLGKKTDGYSGADISVIVRDALMQPVRKVQSAT
HFKKVRGPSRSDPGNIVEDLLTPCSPGDPGAIEMTWMDVPGDKLLEPVVSMSDMLRSLSS
TKPTVNEHDLLKLKKFTEDFGQEG
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtcatccagtagccccaatctccagaaagcaatagatcttgctagcaaggcggcacaa
gaagacaaagctggaaactacgaggaagcccttcagctctaccagcatgctgtgcaatat
tttctccatgtggtcaaatatgaagcacaaggtgacaaagccaagcagagcatcagagca
aaatgcacagaatatcttgacagagccgagaagctgaaggagtatctgaaacagaaggag
aaaaagccacagaagccagtgaaagaagcacagccgagctcagcggatgagaaggggaat
gacagtgatggggaaggagaatctgacgatcctgaaaaaaagaaactgcagaatcagctt
caaggtgccattgttatagagcgaccaaatgtgaaatggagtgatgtagctggtcttgaa
ggagccaaagaagcacttaaggaggctgtgatactgcctattaaatttcctcatttattc
acaggcaagagaacaccttggaggggaatcctattgtttgggccacctggaacaggaaaa
tcctatttagccaaagctgtagcaacagaagcaaacaactcaacatttttttcaatatct
tcctctgaccttgtttctaaatggttaggtgaaagtgaaaaactagttaagaacttgttc
cagcttgccagagaaaacaagccttccattatcttcatagatgaaattgattctttgtgt
ggttcaagaagtgaaaatgaaagtgaagctgcacggagaattaagacagagttcctagtt
caaatgcaaggagttggtgtggacaatgatggaattttggttctgggagctacaaatatc
ccctgggttctggattctgccattaggcgaagatttgagaaacgaatttatattcctttg
cctgaagctcatgcccgagctgccatgtttaaactgcacttggggacgactcagaacagt
ctaacagaaactgacttccgagaccttgggaagaaaacggatggttattcaggggcagat
ataagtgtcattgtacgtgatgcgcttatgcagcccgttagaaaagtacagtcagctact
cactttaaaaaggttcgtggaccttctcgatcagatcctggaaacattgttgaagatcta
ctaacgccctgctctccaggggatcctggtgccattgaaatgacatggatggatgtccct
ggggataaacttttggagccagtggtttccatgtcggatatgttgcggtcactgtctagt
acaaaacccacggtcaatgaacacgatctgttgaaattaaagaagtttacagaagacttt
ggccaagaaggctaa

KEGG   Oryctolagus cuniculus (rabbit): 100340140
Entry
100340140         CDS       T03373                                 
Symbol
VPS4A
Name
(RefSeq) vacuolar protein sorting 4 homolog A
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03250  Viral life cycle - HIV-1
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09125 Information processing in viruses
   03250 Viral life cycle - HIV-1
    100340140 (VPS4A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100340140 (VPS4A)
  09143 Cell growth and death
   04217 Necroptosis
    100340140 (VPS4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340140 (VPS4A)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100340140 (VPS4A)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100340140 (VPS4A)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100340140 (VPS4A)
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 AAA_16 AAA_22 AAA_25 RuvB_N IstB_IS21 AAA_5 AAA_14 AAA_18 DUF815 AAA_2 AAA_33 AAA_17 RNA_helicase AAA_24 PhoH NACHT Mg_chelatase AAA_7 DUF5906 Sigma54_activat bpMoxR Sigma54_activ_2 YhdB
Other DBs
NCBI-GeneID: 100340140
NCBI-ProteinID: XP_002711764
LinkDB
Position
5:24716095..24726850
AA seq 437 aa
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKLKDYLRNKEKHSKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
KPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE
SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARA
QMFRLHLGSTPHSLTDADIHELARKTEGYSGADISVIVRDSLMQPVRKVQSATHFKKVCG
PSRTNPGVMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgacaacgtcaaccctccagaaagccattgatctggtgacgaaagccacagaggaggac
aaagccaagaattacgaggaggccctacggctgtaccagcatgcggtggagtacttcctc
cacgccatcaagtatgaggcgcacagcgacaaggccaaggagagcattcgagccaagtgc
gtgcagtacctagaccgagcggagaagctgaaggattacttacggaacaaggagaagcac
agcaagaagccagtgaaagagaatcagagtgaaggcaagggcagcgatagtgacagcgaa
ggggataacccagagaaaaagaagttgcaggagcagctgatgggtgctgttgtcatggag
aagcccaacatacggtggaatgacgtggcggggctggagggggccaaggaggccctcaaa
gaagctgtcattttaccaattaaattcccacatttgttcacaggcaagcgcaccccctgg
cgagggatactgctctttggaccccctggcacggggaaatcctacctggccaaagctgtg
gccacggaggccaacaactccaccttcttctctgtgtcctcctcagatctgatgtctaag
tggttgggggagagcgagaagctagtgaagaacctgttcgagctggccaggcagcacaag
ccttccatcatcttcatcgatgaggtggattccctctgcggctcccgaaatgagaatgag
agcgaggctgcccgaaggatcaaaacagaattcttggtccagatgcagggggtggggaat
aacaatgatgggactctggttcttggcgccacaaatatcccctgggtattggattcggcc
attagaaggaggtttgaaaaacgaatctacattccgttaccagaggaagctgcccgtgcg
cagatgttccggttacatctggggagcactccccacagcctcacggacgccgacatccac
gagctggcccgcaagacggagggctattctggggcagacatcagcgtcatcgtgcgggac
tccctcatgcagcccgtcaggaaagtgcagtcggcgacacacttcaagaaggtctgtggc
ccttctcgcaccaaccctggcgtcatgatcgacgacctcctgacaccatgctcaccggga
gatcccggggccatggagatgacatggatggatgtccctggtgacaaactcttagagcct
gtggtttgcatgtcggacatgctccgctctttggccaccactcggcccacggtgaacgca
gatgacctcctgaaagtgaagaaattctcagaggacttcggccaggagagctaa

DBGET integrated database retrieval system