KEGG   Oryctolagus cuniculus (rabbit): 100338178
Entry
100338178         CDS       T03373                                 
Symbol
CLTC
Name
(RefSeq) clathrin heavy chain
  KO
K04646  clathrin heavy chain
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04142  Lysosome
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
ocu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100338178 (CLTC)
   04142 Lysosome
    100338178 (CLTC)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100338178 (CLTC)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100338178 (CLTC)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100338178 (CLTC)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100338178 (CLTC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338178 (CLTC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100338178 (CLTC)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    100338178 (CLTC)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100338178 (CLTC)
SSDB
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD TPR_1
Other DBs
NCBI-GeneID: 100338178
NCBI-ProteinID: XP_008269419
Ensembl: ENSOCUG00000016413
UniProt: A0A5F9DCD4
LinkDB
Position
19:complement(28664449..28745858)
AA seq 1682 aa
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMT
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDAIKEKVDKL
DASESLRKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGY
SM
NT seq 5049 nt   +upstreamnt  +downstreamnt
atggcccagattcttccaattcgttttcaggagcatctccagctccagaacctgggaatc
aacccagcgaacattggcttcagtaccctaactatggaatcagacaaatttatctgcatt
agagaaaaagtaggcgagcaagcccaggtggtaatcattgatatgaatgacccaagtaat
cccattcgaagaccaatttcagcagacagtgccatcatgaatccagctagcaaagtaatt
gcattgaaagctgggaaaactcttcagatatttaacattgaaatgaaaagtaaaatgaag
gctcatactatgactgatgatgtcaccttttggaaatggatctctttgaatacggttgcg
cttgttacggataatgcagtttatcattggagtatggaaggcgagtctcagccagtgaaa
atgtttgatcgtcattctagccttgcagggtgccagattatcaattatcgtacagatgca
aagcaaaagtggttacttctgactggcatatccgcacagcaaaatcgtgtggtgggagct
atgcagctgtattctgtagataggaaagtatctcagcctattgaaggacatgcagctagc
tttgcacagtttaaaatggaaggaaatgcagaagaatcaacattgttttgttttgcagta
cgtggtcaagctggagggaagttacatatcattgaagttggcacacctcctacaggaaac
cagccatttccaaagaaggcagtggatgtttttttccctccagaagcgcaaaatgacttt
cctgttgcaatgcagatcagtgaaaagcatgatgtggtattcttgattactaagtatggc
tatattcatctctatgatcttgagactggtacctgtatctacatgaatagaatcagtgga
gaaacaatctttgttactgcacctcacgaagccacagctggaataattggagtaaacaga
aagggacaagttctgtcagtgtgtgtggaagaagaaaacatcattccttatatcaccaat
gtcctacaaaatcctgatttggccttgagaatggctgtccgtaacaacctagctggtgct
gaagaactctttgctcggaaatttaatgctctttttgcccagggaaattactcagaggca
gcaaaggtggctgctaatgcaccaaagggaatcttgcgtactccagacaccattcgtcgg
ttccagagtgtcccagcccagccaggtcagacttctcctctacttcagtactttggaatc
cttttggaccagggacagctaaacaagtatgaatctttagagctgtgtagacctgtactt
caacaaggtcggaaacaacttttggagaaatggttaaaagaagataagctggagtgttct
gaagaactgggtgatcttgtgaaatctgtggaccctactttggcacttagtgtttacctg
agggctaatgtcccaaataaagtcattcagtgctttgcagaaacaggacaagtccagaag
attgtgttatatgctaaaaaggttggatataccccagactggatctttttgctgagaaat
gtaatgcgcatcagtccagatcagggacagcagtttgcacagatgttagtgcaggatgag
gagcctcttgctgatatcacacagattgtagacgtctttatggaatacaatctcattcaa
caatgtactgcgttcttgcttgatgctctgaagaacaatcgcccgtctgaaggtccttta
cagacacgattgctcgagatgaaccttatgcatgcacctcaagttgcagatgctatccta
gggaatcagatgttcacgcattatgaccgagctcatattgctcagttgtgtgaaaaggct
ggcctgctgcagcgtgcgttggagcacttcactgatctgtatgacataaagcgtgcagtt
gttcacacccatcttcttaaccctgagtggttagtgaattactttgggtccttatcagta
gaagactccctagaatgtctcagagccatgctgtctgctaatattcgtcagaatctacag
atctgtgttcaggtggcttctaagtatcatgaacagctatcaactcaatctctgattgaa
ctttttgaatcattcaagagctttgaaggtctcttttattttctgggatccattgttaac
tttagccaggacccagatgtacactttaagtatattcaggcagcttgcaagactgggcaa
atcaaagaagtagaaagaatctgcagagaaagcaactgctatgatcctgagcgagtcaaa
aattttctcaaggaagcaaaactaacagatcaattaccccttatcattgtgtgtgatcga
tttgattttgtccatgatttggtgctttatttatacagaaataatcttcaaaagtatata
gagatatatgtgcagaaggtgaatccaagtcgacttcctgtggttattggaggattactt
gatgttgactgctctgaggatgtcattaaaaacttgattcttgttgtaagaggtcaattc
tctactgatgagcttgttgccgaggttgaaaaaagaaacagattgaaactgcttctgcct
tggctagaagccagaattcatgaaggctgtgaagagcctgctactcacaatgcgttagcc
aaaatctacatagacagtaataacaaccccgagagatttcttcgtgaaaatccctattat
gacagtcgtgttgtgggaaagtattgtgagaagagagacccgcatctggcctgtgttgct
tatgaacgtggccagtgtgatctggagcttattaatgtttgcaatgagaattctctcttc
aaaagcctttcccgctacctggtacgtcgaaaggatccagaattgtggggtagtgtgcta
ttggaaagcaatccttacaggaggcctctgattgaccaggttgtgcagacagctttgtca
gaaactcaagaccctgaagaagtgtcagtaactgttaaggctttcatgactgcagacctt
cctaatgaactcattgaactgctggagaaaattgtccttgataactctgtattcagtgaa
cacaggaatttgcaaaatctcctcattctcactgcaattaaggctgaccgtacacgtgtt
atggagtatattaaccgcctggataattatgatgctccagatattgccaatattgccatc
agcaatgagctctttgaagaagcatttgctattttccggaaatttgatgtcaatacttca
gcagtgcaggtcttgattgaacatattggaaacttggaccgggcatatgagtttgctgaa
cgctgcaatgaacctgcggtctggagtcaacttgcaaaagcccagttgcagaaaggaatg
gtgaaagaagccattgattcttacattaaagctgatgatccttcatcatacatggaagtc
gttcaggctgccaatactagtggaaactgggaagagctggtgaagtacttgcagatggcc
cgtaaaaaggcccgagagtcttatgtggagacggagttgatatttgcactggccaaaact
aaccgtctcgcggagttagaagagttcatcaatgggccaaacaatgctcacatccagcaa
gttggtgatcgttgttatgatgaaaaaatgtatgatgctgctaagttgttatacaacaat
gtttctaattttggacgcttagcatccactctggttcacctaggtgaatatcaggcagct
gttgatggagctaggaaagctaacagtactcgaacatggaaagaggtctgctttgcctgt
gtagatgggaaagagttccgtcttgctcaaatgtgtggactccatattgttgtacatgca
gatgaattagaggaactgatcaactactatcaggatcgaggctattttgaagaactgata
accatgttggaagcagcactgggacttgagcgagctcacatgggaatgtttactgaatta
gctattctgtattctaaatttaagccacagaaaatgagggaacacctggagcttttctgg
tccagagtgaacattcctaaggtgctaagagctgcagaacaagcccacctttgggcagaa
ctggtatttttgtatgacaagtatgaagaatatgataatgccataattaccatgatgact
catccaactgatgcatggaaagaaggacagttcaaagatatcattaccaaggttgccaat
gtggagctctactacagagcaatacagttctacttagaattcaaacctctcttgttaaat
gatttgttgatggtgctgtctccacggctggatcacactcgtgcagtcaattatttcagc
aaggttaaacagctaccactggtgaaaccatatttgcgttccgttcagaaccacaacaac
aaatctgtgaatgagtcattgaataacctcttcattactgaagaggattatcaggctctg
cgaacatcaatagatgcttatgacaactttgacaatatttcacttgctcagcgtttggaa
aaacacgaactcattgagttcagaagaattgctgcttatctcttcaaaggcaacaatcgc
tggaaacagagcgtagagctgtgcaagaaagacagcctttacaaggatgcaatgcagtat
gcctctgaatctaaggatactgagctggccgaagaacttctacagtggtttttgcaggaa
gaaaaaagagaatgctttggagcttgtctcttcacttgttacgatcttttaaggccagat
gttgtcctggaaaccgcatggaggcacaatatcatggattttgccatgccctatttcatc
caggtcatgaaggaatacttgacaaaggttgatgcaataaaggaaaaggtggataaatta
gatgcttcagaatcattgagaaaagaagaagaacaagctacagagacacaacccattgtt
tatggtcagccccaactgatgctgacagcaggacccagtgttgcagttcctccccaggca
ccttttggttatggttatactgcaccaccctatgggcagcctcagcctggctttgggtac
agcatgtga

KEGG   Oryctolagus cuniculus (rabbit): 100350456
Entry
100350456         CDS       T03373                                 
Symbol
CLTA
Name
(RefSeq) clathrin light chain A
  KO
K04644  clathrin light chain A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04142  Lysosome
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
ocu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100350456 (CLTA)
   04142 Lysosome
    100350456 (CLTA)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100350456 (CLTA)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100350456 (CLTA)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100350456 (CLTA)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100350456 (CLTA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100350456 (CLTA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100350456 (CLTA)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    100350456 (CLTA)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   100350456 (CLTA)
SSDB
Motif
Pfam: Clathrin_lg_ch CENP-Q ORC3_N
Other DBs
NCBI-GeneID: 100350456
NCBI-ProteinID: XP_002708032
Ensembl: ENSOCUG00000000009
UniProt: G1SCE4
LinkDB
Position
1:complement(17780842..17804650)
AA seq 236 aa
MAELDPFGTPAGAPGGPALGNGLAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPEAVDGVMNGEYYQESNGPTDGYAAISQVDRLQSEPESIRKWREEQKER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRVADEAFYKQPFADVIGYV
AAEEAFVNDIDESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
NT seq 711 nt   +upstreamnt  +downstreamnt
atggctgagctagatccgttcggcactcccgccggtgctcctggcggtccagcgctgggg
aacgggctggccggagcgggcgaagaagatccggccgcggccttcttggcgcagcaggag
agcgagattgcgggcatcgagaacgacgaggccttcgccatcctggacggcggcgccccc
gggcctcagccgcacggcgagccgccggggggtccggaggctgttgatggagtgatgaat
ggcgaatactaccaggaaagtaatggtcctacagatggttatgcagctatttcacaagtg
gatcgattgcagtcagaacctgaaagtatccggaaatggagagaagagcaaaaagaacgc
ttggaagccctggatgccaattctcggaagcaagaagcagagtggaaagaaaaagcaata
aaagaactagaagagtggtatgcgagacaggacgagcagctacagaaaacaaaagcgaac
aacagggtggcagatgaagctttctacaaacaacccttcgctgacgtgattggttatgtg
gcagcagaagaagcctttgtaaacgacattgatgaatcgtccccaggcactgagtgggaa
cgggtggcccggctatgtgactttaaccccaagtccagcaagcaggccaaagacgtctcc
cgcatgcgctcagttctcatctccctcaagcaggcccccctggtgcactga

KEGG   Oryctolagus cuniculus (rabbit): 100351064
Entry
100351064         CDS       T03373                                 
Symbol
CLTB
Name
(RefSeq) clathrin light chain B
  KO
K04645  clathrin light chain B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04142  Lysosome
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
ocu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351064 (CLTB)
   04142 Lysosome
    100351064 (CLTB)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100351064 (CLTB)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100351064 (CLTB)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100351064 (CLTB)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100351064 (CLTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351064 (CLTB)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    100351064 (CLTB)
SSDB
Motif
Pfam: Clathrin_lg_ch CENP-Q GED
Other DBs
NCBI-GeneID: 100351064
NCBI-ProteinID: XP_002710453
Ensembl: ENSOCUG00000014826
LinkDB
Position
3:complement(56910745..56931943)
AA seq 226 aa
MAEDFGFFPPSESGAAEEDPAAAFLAQQESEIAGIENDEGFAAPAAGQVAAAPPGPASGA
GPEDMGTTVNGDLFQEANGPADGYAAIAQADRLTQEPESIRRWREEQKKRLQELDAASKV
TEQEWREKAKKDLEEWNQRQSEQVEKNKINNRIADKAFYQQPDADVIGYVASEEAFVKES
KEETPGTEWEKVAQLCDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
NT seq 681 nt   +upstreamnt  +downstreamnt
atggctgaggacttcggcttcttcccgccgtccgagagcggggcggctgaggaggacccg
gcggccgccttcctggctcagcaggagagcgagatcgcgggcatcgagaacgacgaaggc
tttgccgcacctgccgccggccaggtggccgcggcgccgccgggacccgcgagcggggct
ggtcctgaggacatggggaccacagtcaatggggacctgtttcaggaggctaatgggcct
gccgacggctacgctgccatcgcccaggctgacaggctgactcaggagcccgagagcatc
cgcagatggagggaggagcagaagaaacggctgcaagagctggatgccgcctctaaggtg
accgaacaggagtggcgggagaaggccaagaaggacctggaggagtggaaccagcgccaa
agcgaacaggttgagaagaacaagatcaacaaccggatcgccgacaaagcattctaccag
cagccggatgctgacgtcatcggctacgtggcgtctgaggaggccttcgtgaaggaatcc
aaggaggagactccaggcacggagtgggagaaggtggctcagctgtgtgacttcaacccc
aagagcagcaagcagtgcaaagacgtgtcccgcctgcgctcggtgctcatgtccttgaag
cagacgccgctttcccgctag

KEGG   Oryctolagus cuniculus (rabbit): 100351366
Entry
100351366         CDS       T03373                                 
Symbol
CLTCL1
Name
(RefSeq) clathrin heavy chain like 1
  KO
K04646  clathrin heavy chain
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04142  Lysosome
ocu04144  Endocytosis
ocu04721  Synaptic vesicle cycle
ocu04961  Endocrine and other factor-regulated calcium reabsorption
ocu05016  Huntington disease
ocu05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351366 (CLTCL1)
   04142 Lysosome
    100351366 (CLTCL1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100351366 (CLTCL1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    100351366 (CLTCL1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100351366 (CLTCL1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100351366 (CLTCL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351366 (CLTCL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100351366 (CLTCL1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    100351366 (CLTCL1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100351366 (CLTCL1)
SSDB
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD TPR_7
Other DBs
NCBI-GeneID: 100351366
NCBI-ProteinID: XP_008248460
Ensembl: ENSOCUG00000001254
LinkDB
Position
Un
AA seq 1673 aa
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIVDMHEPTA
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMSEEVIFWKWISVNTVA
LVTETAVYHWSMEGDSQPTKMFDRHASLAGCQMIHYRADEHHKWLLLIGIAAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKIEGNAKPATLFCFAVRSPAGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQTDFPVAMQIGAKHGVIYLITKAGYLHLYDLESGVCIYMNRISA
DTIFVTAPHEPTSGIIGVNKKGQVLSVCVEEENIVNYATSVLQNPDLGLRLAVRSNLAGA
EELFVRKFSALFAQGSYAEAARVAASAPKGILRTSDTVRKFQSIPAQPGQASPLLQYFGI
LLDQGQLNKLESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKAADPTLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYSPDWMFLLRSVMRVSPEQGLQFAQMLVQDA
EPLANMNQIVDIFMENSLIQQCTSFLLDALKNNQPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHIGQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSLECLRAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYEGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEDVIKNLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESRIQEGCEEPATHNALAKIYIDSNNSPERFLRENAFY
DSSVVGRYCEKRDPHLACVAYERGQCDLDLIKVCNENSLFKSEARYLVRRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSIFSE
HRNLQNLLILTAVKADRTRVMDYISRLDNYDAPDIASIAVSSGLYEEAFAIFRKFDVNAS
AIQVLIEHIGNLDRAYEFAEKCNEPAVWSQLARAQLHKELVKEAIDSFIRADDPSSYLEV
VQAASRSNNWEDLVKFLQMARKRSHESYVETELIFALAKTSRLSELEDCVNGPNNANIQQ
VGDRCYKEGMYEAAKLLYSSVSNFACLASTLVHLGEYQAAVDSSRKANSTRTWKEVCFAC
VDGQEFRLAQLCGLHIVIHADELEDLIQYYQDRGYFEELISLLEAALGLERAHMGMFTEL
AILYSKFKPQKMPEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMIS
HPTEAWKEGQFKDVIAKVANVELYYKALQFYLDYKPLLINDLLVVLSPRLDHTRTVGFFA
KVGQLPLVKPYLRSVQSHNNKSVNEALNQLLTDEEDYQGLRASIDAYDNFDNIGLAQRLE
KHQLIEFRRIAACLYKGSNRWAQSVELCKKDHLYKDAMQHAAESRDAELATKLLQWFLEE
GRRECFAASLFTCYDLLHPDVVLELAWRHNLMDFAMPYFIQVMREYLSKVDKLDAWDSLR
KQEERMVEPAPLVLGQQLMLTAGPAASPAPASFPYGYAAAPAFSQPPVYGFSV
NT seq 5022 nt   +upstreamnt  +downstreamnt
atggcgcagatcctccccatccgcttccaggagcacttccagctccaaaacctgggcatc
aatcctgccaacatcggattcagcacgctgaccatggaatccgacaagttcatatgtgtc
cgagagaaagtgggggagcaggcacaggtggtgatcgttgacatgcacgagccgacggcg
ccgatccggcggcccatctcggcagacagtgccatcatgaacccagcctccaaggtgata
gctctgaaagccgggaagacgcttcagatctttaacattgagatgaaaagtaaaatgaag
gctcacaccatgagcgaagaggtgatcttctggaagtggatctccgtgaacaccgtcgcc
ctggtgaccgagaccgcagtctaccactggagcatggaaggggactcgcagcccacgaag
atgttcgacaggcatgccagcctggcgggctgccagatgatccactaccgtgctgacgag
caccacaagtggctgctgctcatcggcatcgcagcccagcaaaaccgtgtggttggggca
atgcagctctattctgtggacaggaaagtctctcaacccatagaaggccacgccgctgct
ttcgcagagttcaagattgagggcaatgccaagcctgccacccttttctgctttgctgtt
cgcagtcctgcaggaggcaagttgcacataattgaagtgggacagccagcggcaggaaac
cagcctttcgtgaagaaagccgtggatgtgtttttccctccggaggcacagactgatttc
cctgtggctatgcagattggagctaaacacggtgtcatctacttgatcacgaaggctggc
tatcttcacttgtatgacctggagtctggcgtgtgcatctacatgaaccgcatcagtgct
gacacgatctttgtcactgctccgcatgagccgacctccggaattatcggtgttaataaa
aagggacaggtgctgtcggtgtgtgtcgaggaggagaacattgtgaattatgcaaccagt
gtgcttcagaatccggacctgggtctgcgtttagctgttcgtagtaacctggccggggca
gaggagctgtttgtgaggaagttcagtgccctgtttgcacagggaagctatgctgaagcc
gcccgtgtcgccgcatctgcaccaaagggaattctgcgtaccagcgacacggtgcgcaag
ttccagagtattcccgcccagcccgggcaggcctctccgctgctccagtacttcggaatc
ctgcttgaccagggtcagctcaacaaactggaatccttagaactctgccgcccagttctt
cagcagggacgcaagcagctcctggagaagtggctgaaagaagataagctggaatgctca
gaagagctcggagacttggtcaaagccgctgaccccacgcttgccctgagtgtgtacctt
cgggcaaatgtgccaagcaaagtcatccagtgctttgctgaaacaggccaattccagaaa
attgtgctctatgctaaaaaggtcgggtatagcccagactggatgtttctgctgcggagc
gtgatgagggtcagcccagagcaggggctgcagtttgcccagatgctcgtgcaagacgcg
gagccgttggccaacatgaaccagattgtggacattttcatggaaaacagcttaattcag
cagtgtacttccttcttgctggatgccttgaagaacaatcagccagctgaggggcatctg
cagacgcggctgttggagatgaacctgattcacgcaccccaggttgcagatgccatcctt
ggaaatcagatgtttacgcattatgatcgggcccacattggccagctgtgtgagaaggca
ggcctcctgcagcgggctctggagcactacaccgacctctatgacatcaagagggccgtg
gtccacacccatcttctcaatccagagtggctcgtcaacttctttggctccctgtctgtg
gaggattccttggagtgtctgcgggccatgctgtctgcaaacatcagacagaaccttcag
ctgtgcgtgcaggtggcctctaagtaccacgagcagctgggcacgcaggccctggtggag
ctctttgaatccttcaagagttacgaaggcctcttctacttcctgggctcgatcgtgaac
ttcagccaagacccagacgtgcatctgaaatacatccaggctgcctgtaagacggggcag
atcaaggaggtggagaggatctgccgagagagcagctgctacaacccggagcgggtgaag
aacttcctgaaggaggccaagctcactgaccagctccccctaatcatcgtgtgcgaccgc
tttgactttgtgcacgacctggtgctgtacctgtaccgcaacaacctgcagaagtacatt
gagatctacgtgcagaaggtcaaccccagccggatcccagccgtggttggagggttgctg
gacgtggactgctctgaggatgtcattaagaacctaatcatggcagtgagggggcagttc
tccaccgatgagctggtggccgaagtggagaagaggaacaggctcaagttgctacttccc
tggctggagtcccggatccaggagggctgtgaagagcctgccacccacaacgccctggcc
aaaatctacatcgacagcaacaacagccccgaacgcttcttgagagagaacgccttctat
gatagcagcgtggtgggccgctactgcgagaagcgggacccccatctggcctgcgtggcc
tacgaacggggccagtgtgaccttgacctcatcaaggtttgcaatgagaattctctgttc
aaaagtgaggcccgctatctggtgcgccgcaaggacccagaactctgggctcacgtcctg
gaagagaccaacccatctaggagacagctgatcgaccaggtggtacagacagccttgtca
gagacacaggatcctgaggaggtctccgtcactgtcaaggcttttatgacagccgacctg
cccaatgagctgatcgagctgctggagaagattgttctggacaactccatcttcagtgag
cacaggaacctccagaacctactgatcctgaccgccgtcaaggcggaccgcacgcgggtc
atggactatatcagtcgcctggacaactacgacgccccagacattgccagcatcgctgtg
agcagtgggctctacgaagaggccttcgctatcttccgcaagtttgacgtgaatgcctcc
gccatccaggtcctgatcgagcatattggcaacctggaccgcgcgtatgagtttgcagag
aagtgcaatgagcctgccgtgtggagtcagctggcccgtgcccagctccacaaagaactg
gtgaaggaagctattgactcctttatccgagcagatgacccttcttcctacctggaggtc
gtccaggcagccagcaggagcaacaactgggaagatctagttaaattcctgcagatggcc
aggaagaggagccatgagtcgtatgtagagacggagcttatttttgccttggctaaaacc
agccgtctgtctgagctagaagattgtgttaatggacccaacaatgccaacatccagcag
gtgggagaccgctgttacaaggaggggatgtatgaggctgccaagctgctgtatagcagt
gtttctaactttgcctgcctggcttccaccttggtccaccttggtgagtatcaggccgca
gtggacagcagccgcaaggccaacagcacccggacgtggaaggaggtgtgctttgcctgc
gtggacggacaggaattccgtcttgcacagctgtgtgggctgcacatcgtcattcatgca
gacgagctggaggacctgatacaatattaccaggatcgcggctactttgaggagctcatc
tccctgctggaggcagctctgggcctggagcgggcccacatgggcatgttcacggagctg
gccatcctctactccaagttcaagccgcagaagatgccagaacacctggagctcttctgg
tcccgcgtcaacatccccaaggtgctgagggccgcggaacaggcgcacctctgggcagag
ctggtgttcctgtacgacaagtacgaagagtacgacaacgccgtgctcaccatgatcagt
caccccacagaggcctggaaagaaggtcagttcaaggacgtcattgccaaggtggccaac
gtggagctgtactacaaagccctgcagttctacttggattataagcccctgctcatcaat
gacctgctggtggtgctgtcgccccggctggaccacacccgcaccgtgggtttctttgca
aaggtgggccagttgcccctggtgaagccctacctgcggtcagtgcagagccacaacaac
aagagcgtgaatgaggcgctcaaccagctgctgactgacgaggaggactatcagggcttg
agggcctctattgatgcttatgacaacttcgacaacattggcctggcccagcggctggag
aagcaccagctgatcgagttccggcgcatcgctgcctgtctgtacaagggcagcaaccgc
tgggcccagagcgtggagctctgcaagaaggaccacctctacaaggacgccatgcagcac
gcggcggagtcgcgggacgccgagctggccacaaagctgctgcagtggttcctggaggag
ggcaggcgggagtgctttgcagcctccctcttcacctgctacgacctgctgcacccggac
gtggtgctcgagctggcctggaggcacaacctcatggacttcgccatgccctacttcatc
caggtgatgagggagtacctgagcaaggtggacaaactggatgcctgggacagtctgcgc
aagcaagaggagcgcatggtggagcccgccccgcttgtgctgggccagcagctgatgctg
acggcaggccccgcggcctctcctgcccccgccagcttcccctatggatacgctgccgct
cctgccttctcccagcctcccgtgtatggcttcagtgtgtag

DBGET integrated database retrieval system