KEGG   Oryctolagus cuniculus (rabbit): 100338309
Entry
100338309         CDS       T03373                                 
Symbol
SLIT3
Name
(RefSeq) slit guidance ligand 3
  KO
K06850  slit 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100338309 (SLIT3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100338309 (SLIT3)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100338309 (SLIT3)
SSDB
Motif
Pfam: LRR_8 EGF LRR_4 LRR_5 hEGF Laminin_G_2 LRR_9 Laminin_G_1 LRRNT LRRCT EGF_3 Laminin_G_3 LRR_6
Other DBs
NCBI-GeneID: 100338309
NCBI-ProteinID: XP_002710414
Ensembl: ENSOCUG00000017302
LinkDB
Position
3:complement(50061197..50712067)
AA seq 1523 aa
MAPGRTGAVAAVRARLALALALASVLSGPPAVACPTKCTCSAASVDCHGLGLRAVPRGIP
RNAERLDLDRNNITRITKMDFAGLKNLRVLHLEDNQVSVIERGAFQDLKQLERLRLNKNK
LQVLPELLFQSNPKLTRLDLSENQIQGVPRKAFRGIADVKNLQLDNNHISCIEDGAFRAL
RDLEILTLNNNNISRILVTSFNHMPKIRTLRLHSNHLYCDCHLAWLSDWLRQRRTIGQFT
LCMAPVHLRGFNVADVQKKEYVCPVPHSEPPSCNANSLACPSACTCSNNIVDCRAKGLTE
IPTNLPEGIIEIRLEQNSIKSIPAGAFTPYKKLKRIDISKNQISDIAPDAFQGLKSLTSL
VLYGNKITEIAKGLFDGLVSLQLLLLNANKINCLRVNTFQDLQNLNLLSLYDNKLQTISK
GLFAPLQSIQTLHLAQNPFVCDCHLKWLADYLQDNPIETSGARCSSPRRLANKRISQIKS
KKFRCSGSEDYRNRFSSECFMDLVCPEKCRCEGTIVDCSNQKLARIPSHLPEYVTDLRLN
DNEISVLEATGIFKKLPNLRKINLSNNKIKEMREGVFDGAASVQELMLTGNQLESVHGRM
FRGLTGLKTLMLRSNLISCVGNDTFAGLSAVRLLSLYDNRITTITPGAFTTLVSLSTINL
LSNPFNCNCHLAWLGKWLRKRRIVSGNPRCQKPFFLKEIPIQDVAIQDFTCEGNDESSCQ
LSPRCPEQCTCVETVVRCSNKGLRALPKGMPKDVTELYLEGNHLTAVPRELSALRHLTLI
DLSNNSIGMLTNYTFSNMSHLSTLILSYNRLRCIPVHAFNGLRSLRVLTLHGNDISSVPE
GSFNDLTSLSHLALGTNPLHCDCSLRWLSEWVKAGYKEPGIARCSSPESMADRLLLTTPT
HRFQCKGPVDINIVAKCNACLSSPCKNNGTCSQDAVELYRCTCPYSYKGKDCSVPINTCI
QNPCLHGGTCHLSESHKDGFSCSCPLGFEGQRCEINPDDCEDNDCENNATCVDGINNYVC
VCPPNYTGELCDEVIDHCVPGMNLCQHEAKCISLDRGFRCDCVPGYSGKLCEVDNDDCVG
HKCRHGAQCVDAVNGYTCICPQGFSGLFCEHPPPMVLLQTSPCDQYECQNGAQCIVVQQE
PTCRCPPGFAGPRCEKLITVNFVGKDSYVELASAKVRPQANISLQVATDKDNGILLYKGD
NDPLALELYQGHVRLVYDTLSSPPTTVYSVETVNDGQFHSVELVMLNQTLNLVVDKGAPK
SLGKLQKQPAVVTNSPLYLGGIPTSTGLSALRQGTDRPLGGFHGCIHEVRINNELQDFKA
LPPQSLGVSPGCKSCTVCKHGLCRSVEKDSVVCECHPGWTGPLCDQEARDPCLSHSCNHG
TCVATGTSYVCKCAEGYGGALCDHKNESANACSAFKCHHGQCHISDRGEPYCVCQPGFSG
EHCEQETPCLGEVVREVIRRQKGYASCATASKVPMVECRGGCGPQCCQPTRSKRRKYVFQ
CTDGSSFVEEVERHLECGCHPCS
NT seq 4572 nt   +upstreamnt  +downstreamnt
atggcccccgggcggacaggggccgtagccgccgtgcgcgcccgcctggcgctggccttg
gcgctggcgagcgtcctgagcgggccccccgccgtcgcctgccccaccaagtgtacctgc
tctgccgccagcgtggactgccacgggctgggcctccgggccgttccccggggcatcccc
cgcaacgccgagcgccttgacctggaccgaaataatatcaccagaatcaccaagatggac
tttgctggactgaagaacctccgcgtcttgcatctggaagacaaccaggtcagcgtcatt
gagagaggcgccttccaggatctgaagcagctggagcgactgcgtctgaacaagaataag
ctccaagtccttccagaattgcttttccagagcaatccgaagctcaccagactagatctg
agcgagaaccagatccagggggtcccgaggaaggcgttccgcggcattgctgacgtgaag
aacctgcaactggacaacaaccacatcagctgcattgaagatggagccttccgtgcactg
cgcgatttggagatcctcaccctcaacaacaacaacattagccgcatcctggtcaccagc
ttcaaccacatgccgaagattcgaactctgcgcctccactccaaccacctgtactgcgac
tgccacctggcctggctctcggattggctgcgacagcggcggacaattggccagttcacg
ctctgcatggctcctgtgcacctgaggggcttcaatgtggcggatgtgcagaagaaggag
tatgtgtgcccagtcccccactcggagccgccatcctgcaatgccaactcactcgcctgc
ccttcagcctgcacttgcagtaataacatcgtggactgccgcgcaaagggtctcacagag
atccccaccaacttgccggagggcatcatcgaaatacgcctagaacagaactccatcaag
tccatccctgcaggagccttcaccccgtacaagaagctgaagagaatagacatcagcaag
aatcagatatcggacatcgcgccagatgccttccagggcctgaagtcactcacatcgctg
gtgctctatgggaacaagatcaccgagattgccaagggcctgtttgatgggctggtgtcc
ctgcagctgctcctcctcaatgccaacaagatcaactgcctgcgggtgaacacatttcag
gacctgcagaacctcaacctgctctccctgtatgacaacaagctgcagaccatcagcaag
ggactcttcgctcctctgcagtccatccagacgctccacttagcccagaaccccttcgtg
tgtgactgtcacttgaagtggctggctgactacctccaggacaaccccatcgagacgagc
ggggcccgctgcagcagcccgcgccggctcgccaacaagcgcatcagccagatcaagagc
aagaagttccgctgctcaggctccgaggattaccgcaacaggttcagcagcgagtgcttt
atggacctcgtgtgccccgagaagtgccgctgcgagggcaccattgtggactgctccaac
cagaagctggcccgcatcccaagccacctccctgaatatgtcaccgatctgcggctgaac
gacaacgagatctcggttctggaggccactggtatcttcaagaagctgcccaacctgcgg
aaaataaacctgagcaacaataagatcaaggaaatgcgagagggcgtcttcgatggagca
gccagcgtgcaggagctcatgctgacgggcaaccagctggagagcgtgcacgggcgcatg
ttccgaggcctcaccggcctgaagaccttgatgctgcgcagtaacctgatcagctgtgtg
ggcaatgacaccttcgccggcctgagcgcagtgaggctgctgtcgctctacgacaatcgc
atcaccaccatcacccccggagccttcaccacgctcgtctccctgtccaccataaacctc
ctgtccaaccccttcaactgcaactgccacctggcctggctgggcaagtggctgaggaag
aggcggatcgtcagtgggaacccccggtgccagaagccgttcttcctcaaggagatcccc
atccaggacgtggccatccaggacttcacctgcgagggcaatgacgagagcagctgccag
ctgagtccacgatgcccggagcagtgcacctgcgtggagacggtggtacgatgcagcaac
aaggggctccgcgccctccccaaaggcatgcccaaggacgtcaccgagctgtacctggaa
ggaaaccacttaacagctgtgcccagagagctgtctgccctccgacacctgacactgatt
gacctgagcaacaacagcatcggcatgctgaccaactacaccttcagtaacatgtcccac
ctctccactctgatcctgagctacaaccggctgcgctgcatccccgtccatgccttcaac
ggactgcggtctctccgagtgctaaccctccatggcaacgacatttccagcgttccagaa
ggctccttcaacgacctcacatctctttcccatctggcgctgggaaccaacccgctgcac
tgtgactgcagtctgcgttggctgtccgagtgggtgaaggcaggatacaaggagcctggc
atcgcccgctgcagtagccctgagtccatggctgaccgactgctgctcaccacccccacc
caccgattccagtgcaaagggccagtagacatcaacattgtggccaagtgcaatgcctgc
ctctccagcccatgcaagaacaacgggacgtgcagccaggacgccgtggagctgtaccgc
tgcacctgcccctacagctacaagggcaaggactgcagcgtacccatcaacacctgcatc
cagaacccctgtctgcacggaggcacctgccacctgagcgagagccacaaggacggcttc
agctgctcctgcccactgggcttcgaggggcagcggtgtgagatcaaccccgatgactgt
gaggacaacgactgtgagaacaacgccacctgtgtagatggcatcaacaactatgtgtgt
gtctgcccgcctaactacacaggtgaactgtgcgatgaggtgattgaccactgtgtgccc
gggatgaacctctgtcagcatgaggccaagtgcatctccctggacagagggttcaggtgt
gactgtgtccctggctacagcggcaagctctgcgaggtagacaatgacgactgtgtgggc
cacaagtgccgccacggcgcccagtgcgtggatgcggtcaacggctacacatgcatctgt
cctcagggcttcagcgggctcttctgcgagcaccccccgcccatggtcctgctgcagacc
agcccctgtgaccagtacgagtgccagaatggagcccagtgcatcgtggtgcagcaggag
cccacctgccgctgtccccccggcttcgctggccccaggtgtgagaagctcatcaccgtc
aacttcgtgggcaaggactcctacgtggaattggcctccgccaaggtccggccccaggcc
aacatctccctgcaggtggccaccgacaaagacaatggcatcctgctctacaagggagac
aatgaccccctggcgctggagctctaccagggccacgtgaggctggtctatgacaccctg
agctcacctccaaccacagtgtacagcgtggagacagtgaacgacgggcagtttcacagt
gtggagctggtgatgctgaaccagaccctgaacctggtggtggacaaaggagcccccaag
agcctgggaaagctccagaaacagccggcagtggtcaccaacagccccctctaccttgga
ggcattcccacctccacgggcctctcggccttgcgccagggcacagaccggccgctgggc
ggctttcacggctgtatccacgaggtgcgcatcaacaacgagctgcaggacttcaaggcc
ctcccgccgcagtcgctgggggtctcgccaggctgcaagtcctgcacggtgtgcaagcac
ggcctgtgccgctcggtggagaaggacagcgtggtgtgtgagtgccaccctggctggaca
ggccctctgtgcgaccaggaggcccgggacccctgcctcagccacagctgcaaccacgga
acatgcgtggcgaccgggacctcatacgtgtgcaagtgtgccgagggctatggaggggct
ttgtgtgaccacaagaacgagtctgccaatgcctgctcagccttcaagtgtcaccacgga
cagtgccacatctccgatcgaggggaaccctactgcgtgtgccagcccggcttcagcggg
gagcactgtgaacaagaaaccccgtgcctgggggaggtggttcgagaggtgatccgccgc
cagaaagggtatgcgtcatgcgccacagcctctaaggtgcccatggtggagtgtcgcggg
ggctgcggcccccagtgctgccagcccacccgcagcaagaggcggaaatacgtcttccag
tgcacggacggctcctcgtttgtggaagaggtggagagacacttagagtgtggctgccac
ccctgctcctaa

DBGET integrated database retrieval system