Oryctolagus cuniculus (rabbit): 100338345 Help Entry 100338345         CDS       T03373                                  Name (RefSeq) protein c-Fos   KO K04379   proto-oncogene protein c-fos Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01522   Endocrine resistance ocu04010   MAPK signaling pathway ocu04024   cAMP signaling pathway ocu04210   Apoptosis ocu04380   Osteoclast differentiation ocu04620   Toll-like receptor signaling pathway ocu04657   IL-17 signaling pathway ocu04658   Th1 and Th2 cell differentiation ocu04659   Th17 cell differentiation ocu04660   T cell receptor signaling pathway ocu04662   B cell receptor signaling pathway ocu04668   TNF signaling pathway ocu04713   Circadian entrainment ocu04725   Cholinergic synapse ocu04728   Dopaminergic synapse ocu04915   Estrogen signaling pathway ocu04917   Prolactin signaling pathway ocu04921   Oxytocin signaling pathway ocu04926   Relaxin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04932   Non-alcoholic fatty liver disease ocu04935   Growth hormone synthesis, secretion and action ocu05031   Amphetamine addiction ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05140   Leishmaniasis ocu05142   Chagas disease ocu05161   Hepatitis B ocu05162   Measles ocu05166   Human T-cell leukemia virus 1 infection ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05170   Human immunodeficiency virus 1 infection ocu05171   Coronavirus disease - COVID-19 ocu05200   Pathways in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05208   Chemical carcinogenesis - reactive oxygen species ocu05210   Colorectal cancer ocu05224   Breast cancer ocu05231   Choline metabolism in cancer ocu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer ocu05323   Rheumatoid arthritis ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100338345    04024 cAMP signaling pathway     100338345  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100338345    04660 T cell receptor signaling pathway     100338345    04658 Th1 and Th2 cell differentiation     100338345    04659 Th17 cell differentiation     100338345    04657 IL-17 signaling pathway     100338345    04662 B cell receptor signaling pathway     100338345   09152 Endocrine system    04915 Estrogen signaling pathway     100338345    04917 Prolactin signaling pathway     100338345    04921 Oxytocin signaling pathway     100338345    04926 Relaxin signaling pathway     100338345    04935 Growth hormone synthesis, secretion and action     100338345    04928 Parathyroid hormone synthesis, secretion and action     100338345   09156 Nervous system    04725 Cholinergic synapse     100338345    04728 Dopaminergic synapse     100338345   09158 Development and regeneration    04380 Osteoclast differentiation     100338345   09159 Environmental adaptation    04713 Circadian entrainment     100338345  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100338345    05207 Chemical carcinogenesis - receptor activation     100338345    05208 Chemical carcinogenesis - reactive oxygen species     100338345    05231 Choline metabolism in cancer     100338345    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100338345   09162 Cancer: specific types    05210 Colorectal cancer     100338345    05224 Breast cancer     100338345   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100338345    05170 Human immunodeficiency virus 1 infection     100338345    05161 Hepatitis B     100338345    05171 Coronavirus disease - COVID-19     100338345    05162 Measles     100338345    05167 Kaposi sarcoma-associated herpesvirus infection     100338345   09171 Infectious disease: bacterial    05135 Yersinia infection     100338345    05133 Pertussis     100338345   09174 Infectious disease: parasitic    05140 Leishmaniasis     100338345    05142 Chagas disease     100338345   09163 Immune disease    05323 Rheumatoid arthritis     100338345   09165 Substance dependence    05031 Amphetamine addiction     100338345   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100338345    05418 Fluid shear stress and atherosclerosis     100338345   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100338345   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100338345  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:ocu03000]     100338345    04131 Membrane trafficking [BR:ocu04131]     100338345 Transcription factors [BR:ocu03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     100338345 Membrane trafficking [BR:ocu04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100338345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  100338345 NCBI-ProteinID:  XP_002719685 Ensembl:  ENSOCUG00000021506 UniProt:  G1TWI8 LinkDB All DBs Position 20:complement(29515085..29518360) Genome browser AA seq 380 aa AA seqDB search MMFSGFNADYEAASSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCSDLAVSTANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPAPSAGAYPRAGNVKTLTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVGSLDLSGGLPEAATPESEEPFS LPLLNDPEPKPAVEPGKNLSGMELKAEPFDDFLFPASSRPSGSETARSVPDVDLSGSFYA ADWEPLHSGALGMGPMAAELEPLCTPVVTCTPSCTTYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgccgactacgaggcagcgtcttcccgctgcagcagcgcc tcgccagccggggacagcctctcctactaccactccccagccgactccttctccagcatg ggctccccggtcaatgcgcaggacttctgttcggatctggccgtctccactgccaacttc atccccaccgtgactgccatctcgaccagcccggacctgcagtggctggtgcagcccacc ctggtctcttccgtggctccgtcgcagaccagagccccccacccttacggagtccccgcc ccctcggctggggcttacccccgggctggaaacgtgaagaccctgaccggaggcagagct cagagcatcggccgaaggggcaaggtggagcagttgtcacccgaggaagaggagaagagg cgaatccgaagggaaaggaataagatggctgcagccaagtgccgaaaccggaggcgggag ctcaccgataccctgcaggcggagacagatcagctagaagacgagaagtctgcgctgcag acggagatcgccaacctgctcaaggagaaggagaagctggagttcatcctggcagcccac cggcccgcctgcaagatccccgatgacctgggcttccccgaggagatgtccgtgggatcc ctggatctgagcgggggcctgcccgaggctgccaccccggagtccgaggagcctttcagt ctgcccctcctcaacgacccggagcctaagcccgcagtggagcccggcaagaacctgagc ggcatggagctgaaggccgagcccttcgatgacttcctgttcccagcgtcatccaggccc agcggctcggagacggcacgctctgtgccggacgtggacctgtccggttccttctatgcc gcagactgggagcccctgcacagtggcgccctggggatggggccgatggctgcggagctg gagcccctgtgcaccccggtggtcacctgtaccccaagctgcaccacttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgcgccgcggcccaccgcaag ggcagcagcagcaacgagccctcctctgactcgctcagctccccgacactgctcgccctg tga

DBGET integrated database retrieval system