KEGG   Oryctolagus cuniculus (rabbit): 100338391
Entry
100338391         CDS       T03373                                 
Symbol
GNAI1
Name
(RefSeq) G protein subunit alpha i1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04360  Axon guidance
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04713  Circadian entrainment
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04924  Renin secretion
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04971  Gastric acid secretion
ocu05012  Parkinson disease
ocu05030  Cocaine addiction
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05133  Pertussis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05163  Human cytomegalovirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100338391 (GNAI1)
   04371 Apelin signaling pathway
    100338391 (GNAI1)
   04071 Sphingolipid signaling pathway
    100338391 (GNAI1)
   04024 cAMP signaling pathway
    100338391 (GNAI1)
   04022 cGMP-PKG signaling pathway
    100338391 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100338391 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100338391 (GNAI1)
   04670 Leukocyte transendothelial migration
    100338391 (GNAI1)
   04062 Chemokine signaling pathway
    100338391 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100338391 (GNAI1)
   04915 Estrogen signaling pathway
    100338391 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    100338391 (GNAI1)
   04921 Oxytocin signaling pathway
    100338391 (GNAI1)
   04926 Relaxin signaling pathway
    100338391 (GNAI1)
   04935 Growth hormone synthesis, secretion and action
    100338391 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    100338391 (GNAI1)
   04916 Melanogenesis
    100338391 (GNAI1)
   04924 Renin secretion
    100338391 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100338391 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    100338391 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100338391 (GNAI1)
   04727 GABAergic synapse
    100338391 (GNAI1)
   04725 Cholinergic synapse
    100338391 (GNAI1)
   04728 Dopaminergic synapse
    100338391 (GNAI1)
   04726 Serotonergic synapse
    100338391 (GNAI1)
   04730 Long-term depression
    100338391 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    100338391 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    100338391 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100338391 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100338391 (GNAI1)
   05207 Chemical carcinogenesis - receptor activation
    100338391 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100338391 (GNAI1)
   05163 Human cytomegalovirus infection
    100338391 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100338391 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100338391 (GNAI1)
   05142 Chagas disease
    100338391 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100338391 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    100338391 (GNAI1)
   05032 Morphine addiction
    100338391 (GNAI1)
   05034 Alcoholism
    100338391 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100338391 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100338391 (GNAI1)
   04031 GTP-binding proteins [BR:ocu04031]
    100338391 (GNAI1)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100338391 (GNAI1)
GTP-binding proteins [BR:ocu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100338391 (GNAI1)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100338391
NCBI-ProteinID: XP_002712064
Ensembl: ENSOCUG00000001020
LinkDB
Position
7:complement(35799984..35912806)
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKVDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcggagcaagatgatcgac
cgcaacctgcgtgaggatggcgagaaggcggcgcgcgaggtcaagctgctgctgctcggt
gctggtgaatccgggaaaagcacaattgtgaagcagatgaaaatcatccatgaagccggc
tactcggaagaggagtgtaaacagtacaaagccgtggtctacagcaacaccatccagtcc
attatcgctatcatcagggccatggggaggctgaaggtagacttcggcgactcagctcgg
gcggatgatgcccgccaactctttgtgcttgctggagctgctgaggaaggctttatgact
gcagaactcgccggagtgataaagagattgtggaaggatagcggtgtgcaagcctgtttc
aacagatcccgcgagtaccagcttaatgactcggcagcgtactatttgaatgacttggac
agaatagcacaacccaattatatcccaactcagcaagacgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggacagaggtccgaacggaagaagtggatccactgcttcgagggagtgactgcc
atcatcttctgtgtggcactgagtgactatgacctggtcctggctgaagacgaagagatg
aatcgaatgcatgaaagcatgaaattgttcgacagcatatgtaacaacaaatggtttaca
gacacgtccatcatactttttctaaacaagaaggacctctttgaagaaaaaattaaaaag
agccctctcactatttgctatccagaatatgcaggatcaaacacgtacgaagaggcagcc
gcatatattcagtgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtctcttctaa

KEGG   Oryctolagus cuniculus (rabbit): 100339066
Entry
100339066         CDS       T03373                                 
Symbol
GNAI2
Name
(RefSeq) G protein subunit alpha i2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04360  Axon guidance
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04713  Circadian entrainment
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04924  Renin secretion
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04971  Gastric acid secretion
ocu05012  Parkinson disease
ocu05030  Cocaine addiction
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05133  Pertussis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05163  Human cytomegalovirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100339066 (GNAI2)
   04371 Apelin signaling pathway
    100339066 (GNAI2)
   04071 Sphingolipid signaling pathway
    100339066 (GNAI2)
   04024 cAMP signaling pathway
    100339066 (GNAI2)
   04022 cGMP-PKG signaling pathway
    100339066 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100339066 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100339066 (GNAI2)
   04670 Leukocyte transendothelial migration
    100339066 (GNAI2)
   04062 Chemokine signaling pathway
    100339066 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100339066 (GNAI2)
   04915 Estrogen signaling pathway
    100339066 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    100339066 (GNAI2)
   04921 Oxytocin signaling pathway
    100339066 (GNAI2)
   04926 Relaxin signaling pathway
    100339066 (GNAI2)
   04935 Growth hormone synthesis, secretion and action
    100339066 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    100339066 (GNAI2)
   04916 Melanogenesis
    100339066 (GNAI2)
   04924 Renin secretion
    100339066 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100339066 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    100339066 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100339066 (GNAI2)
   04727 GABAergic synapse
    100339066 (GNAI2)
   04725 Cholinergic synapse
    100339066 (GNAI2)
   04728 Dopaminergic synapse
    100339066 (GNAI2)
   04726 Serotonergic synapse
    100339066 (GNAI2)
   04730 Long-term depression
    100339066 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    100339066 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    100339066 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100339066 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100339066 (GNAI2)
   05207 Chemical carcinogenesis - receptor activation
    100339066 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100339066 (GNAI2)
   05163 Human cytomegalovirus infection
    100339066 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100339066 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100339066 (GNAI2)
   05142 Chagas disease
    100339066 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100339066 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    100339066 (GNAI2)
   05032 Morphine addiction
    100339066 (GNAI2)
   05034 Alcoholism
    100339066 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100339066 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100339066 (GNAI2)
   04031 GTP-binding proteins [BR:ocu04031]
    100339066 (GNAI2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100339066 (GNAI2)
GTP-binding proteins [BR:ocu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100339066 (GNAI2)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Other DBs
NCBI-GeneID: 100339066
NCBI-ProteinID: XP_008258899
Ensembl: ENSOCUG00000011681
UniProt: G1TRG8
LinkDB
Position
9:17699236..17717895
AA seq 355 aa
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADTSRNDDARQLFALSAAAEEQGVL
PEDLSGVIRRLWADQGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSHLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgggctgcacggtgagcgccgaggacaaggcggcggccgagcgctcaaagatgatcgac
aagaacttgcgggaggatggcgagaaggcggcgcgggaggtgaagttgctgttgttgggt
gccggggagtccgggaagagtaccatcgtcaagcagatgaagatcatccacgaggatggc
tactcggaggaggaatgccggcagtaccgggcagtggtctacagcaacaccatccagtcc
atcatggccattgtcaaggccatgggcaacctgcagattgactttgccgacacctcccgc
aatgacgatgccaggcagctgtttgcgctgtcagctgctgccgaggagcagggagtgctc
cctgaggacctgtctggcgtcatccggaggctctgggctgaccaaggggtgcaggcctgc
tttggccgctcgcgggagtaccagctcaacgactcagccgcctactacctgaacgacctg
gagcgcatcgcacagagtgactacatccccacgcagcaggacgtgctgcgcacccgcgtg
aagaccacagggatcgtggagacgcacttcaccttcaaggacctgcacttcaagatgttt
gatgtgggtggccagcggtcggagcggaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtcgccctgagcgcctatgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctgtttgacagcatctgcaacaacaagtggttc
acggacacgtccatcatcctcttcctcaacaagaaggacctgtttgaggagaagatcaca
cacagccacctgaccatctgctttcctgagtacacaggggccaacaagtatgacgaggca
gccagctacatccagagcaagtttgaggacctgaacaagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgttcgacgctgtc
accgacgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Oryctolagus cuniculus (rabbit): 100359147
Entry
100359147         CDS       T03373                                 
Symbol
GNAI3
Name
(RefSeq) G protein subunit alpha i3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04062  Chemokine signaling pathway
ocu04071  Sphingolipid signaling pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04360  Axon guidance
ocu04371  Apelin signaling pathway
ocu04540  Gap junction
ocu04611  Platelet activation
ocu04670  Leukocyte transendothelial migration
ocu04713  Circadian entrainment
ocu04723  Retrograde endocannabinoid signaling
ocu04724  Glutamatergic synapse
ocu04725  Cholinergic synapse
ocu04726  Serotonergic synapse
ocu04727  GABAergic synapse
ocu04728  Dopaminergic synapse
ocu04730  Long-term depression
ocu04914  Progesterone-mediated oocyte maturation
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04921  Oxytocin signaling pathway
ocu04923  Regulation of lipolysis in adipocytes
ocu04924  Renin secretion
ocu04926  Relaxin signaling pathway
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04971  Gastric acid secretion
ocu05012  Parkinson disease
ocu05030  Cocaine addiction
ocu05032  Morphine addiction
ocu05034  Alcoholism
ocu05133  Pertussis
ocu05142  Chagas disease
ocu05145  Toxoplasmosis
ocu05163  Human cytomegalovirus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05200  Pathways in cancer
ocu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100359147 (GNAI3)
   04371 Apelin signaling pathway
    100359147 (GNAI3)
   04071 Sphingolipid signaling pathway
    100359147 (GNAI3)
   04024 cAMP signaling pathway
    100359147 (GNAI3)
   04022 cGMP-PKG signaling pathway
    100359147 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100359147 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100359147 (GNAI3)
   04670 Leukocyte transendothelial migration
    100359147 (GNAI3)
   04062 Chemokine signaling pathway
    100359147 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100359147 (GNAI3)
   04915 Estrogen signaling pathway
    100359147 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    100359147 (GNAI3)
   04921 Oxytocin signaling pathway
    100359147 (GNAI3)
   04926 Relaxin signaling pathway
    100359147 (GNAI3)
   04935 Growth hormone synthesis, secretion and action
    100359147 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    100359147 (GNAI3)
   04916 Melanogenesis
    100359147 (GNAI3)
   04924 Renin secretion
    100359147 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100359147 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    100359147 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    100359147 (GNAI3)
   04727 GABAergic synapse
    100359147 (GNAI3)
   04725 Cholinergic synapse
    100359147 (GNAI3)
   04728 Dopaminergic synapse
    100359147 (GNAI3)
   04726 Serotonergic synapse
    100359147 (GNAI3)
   04730 Long-term depression
    100359147 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    100359147 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    100359147 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100359147 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100359147 (GNAI3)
   05207 Chemical carcinogenesis - receptor activation
    100359147 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100359147 (GNAI3)
   05163 Human cytomegalovirus infection
    100359147 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100359147 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100359147 (GNAI3)
   05142 Chagas disease
    100359147 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    100359147 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    100359147 (GNAI3)
   05032 Morphine addiction
    100359147 (GNAI3)
   05034 Alcoholism
    100359147 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100359147 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100359147 (GNAI3)
   04031 GTP-binding proteins [BR:ocu04031]
    100359147 (GNAI3)
Exosome [BR:ocu04147]
 Exosomal proteins
  Proteins found in most exosomes
   100359147 (GNAI3)
GTP-binding proteins [BR:ocu04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    100359147 (GNAI3)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 AAA_16 FtsK_SpoIIIE
Other DBs
NCBI-GeneID: 100359147
NCBI-ProteinID: XP_002715849
Ensembl: ENSOCUG00000005553
UniProt: G1SP68
LinkDB
Position
13:complement(54598429..54650388)
AA seq 354 aa
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQTNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcggtggagcggagcaagatgatcgac
cgcaacttgcgggaggacggagagaaagcggccaaagaagtgaagctgctgctcctcggt
gctggggaatctggtaaaagcactatcgtgaaacagatgaaaatcattcatgaggatggc
tattcagaggaagaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggcttaagattgactttggggaagcagccaga
gcagatgatgcccggcaattatttgttttagctggcagtgctgaagaaggagtgatgact
ccagaattagcaggagtgattaaacggttatggcgagatggtggggtacaagcttgcttc
agcagatccagggaatatcagctcaatgattctgcttcatattacctaaatgatttggat
agaatatcccaaaccaactacattccaactcagcaagatgttctccggacaagagtgaag
accacaggcattgtggaaacgcatttcaccttcaaagatctatatttcaaaatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgaccgca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggatgaagagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaacaacaaatggtttaca
gacacttcaatcattctcttccttaacaagaaagatctttttgaggaaaaaataaagagg
agtcctttaactatctgttacccagaatacacaggttccaatacatatgaagaagcagct
gcttacattcagtgccagtttgaagatctgaacagaagaaaagataccaaggagatctac
actcacttcacctgtgccacagacaccaaaaatgtgcagtttgtttttgatgctgtcaca
gatgtcatcattaaaaacaacttgaaggaatgtgggctttactga

DBGET integrated database retrieval system