KEGG   Oryctolagus cuniculus (rabbit): 100338427
Entry
100338427         CDS       T03373                                 
Symbol
UNC5B
Name
(RefSeq) unc-5 netrin receptor B
  KO
K07521  netrin receptor unc-5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100338427 (UNC5B)
SSDB
Motif
Pfam: UPA ZU5 Death I-set TSP1_spondin Ig_3 TSP_1 ig Ig_2 TSP1_ADAMTS Chromo_2 SKG6
Other DBs
NCBI-GeneID: 100338427
NCBI-ProteinID: XP_008268491
Ensembl: ENSOCUG00000006943
LinkDB
Position
18:complement(15906998..15977725)
AA seq 934 aa
AAGVAAVWDPRLSRAGTDSGSEVLPDSFPSAPAEPLPHFLQEPQDAYIVKNKPVELRCRA
FPATQIYFKCNGEWVSQNDHVTQEGVDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCV
AWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHQVLLQCRPPEGVPVAEVEWLKNE
DVIDPSQDTNFLITIEHNLIIRQARLLDTANYTCVAKNIVAKRRSTTATIIVYVNGGWSS
WADWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCPVDGAWTEWSKW
SACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVHNKRTLSDPKSHLLESS
GDVALYAGLVVAVLVAVAVLSVVAVVVYRRNCRDFHSDITDSSAALTGGFHPVNFKTARP
NNPQLLHPPVPPDLTASAGIYRGPVYALQDSADKIPMTNSPLLDPLPNLKIKVYSSGTTG
SAPGLPDGADLLGVLPPGTYPGEFPRDAHFLHLRSASLGSQQLLGLPRDPGSSVSGTFGC
LGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINTAESTLPLSEGTQTVLSPSVTCGPTG
LLLCRPVILSVPHCAQVSAGDWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLEASSCH
ILLDQLGTYVLTGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLQDTPVALKEVLELE
RTLGGYLVEEPKPLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFCHVWGGSPKALH
CTFTLERHSLAATEFSCKICVRQVEGEGQIFQLHTTLAETPAGSLDALCSAPGSAVTTQL
GPYAFKIPLSIRQKICNSLDAPNARGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWE
ALQQDDGDLNSLASALEEMGKSEMLVAMATDGDC
NT seq 2805 nt   +upstreamnt  +downstreamnt
gctgctggcgttgctgctgtgtgggacccgcggctgagccgagcaggcactgattctggc
agtgaggtgctccccgactccttcccgtcggcgcccgcagagccgctgccccacttcctg
caggagccgcaggatgcctacatcgtcaagaacaagccggtggagctgcgctgccgtgcc
ttccccgccacccagatctacttcaagtgcaatggcgagtgggtcagccagaacgaccac
gtgacgcaggagggcgtggacgaggccactggcctgcgggtgcgagaggtgcagatcgag
gtgtcgcggcagcaggtggaggagctgttcgggctggaggactactggtgccagtgtgtg
gcctggagctccgcaggcaccaccaagagccgccgtgcctatgtccgcatcgcctacctg
cgcaagaacttcgaccaggagcctctgggcaaggaggtgcccctggaccaccaggtgctc
ctgcagtgccgcccgccagagggggtgcctgtggctgaggtggagtggctcaagaacgag
gatgtcatcgaccccagccaggacaccaacttcctgatcaccatcgagcacaacctcatc
attcgccaggctcgcctgctggacacggccaactacacctgcgtggccaagaacatcgtg
gccaagcgccggagcaccacggccaccatcatcgtctatgtgaacggcggctggtccagc
tgggcagactggtcgccctgctccaaccgctgtggccgaggctggcagaagcgcacacgg
acctgcaccaaccccgcccctctcaacggaggggccttctgcgagggccaggccttccag
aagacagcctgcaccactgtgtgcccagttgacggggcgtggacggagtggagcaagtgg
tccgcctgcagcaccgagtgcgcgcactggcgcagccgcgagtgcatggcgccgccgccc
cagaacggaggccgcgactgcagcgggacgttgctcgactccaagaactgcacggacggg
ctctgcgtgcacaataagagaactctaagcgaccccaaaagccacctcctggagtcctcg
ggggacgtggcactgtatgcgggcctcgtggtggccgtgctggtggccgtggcggtcctg
tccgtggtggcggtggtggtgtaccgccgaaactgccgtgacttccacagtgacatcacc
gactcatctgccgccctcaccggtggattccacccggttaacttcaagacagccaggccc
aacaacccgcagctgctgcacccgcctgtgcctcctgacctgacagccagcgccggcatc
taccgtgggcccgtgtatgccctgcaggactccgctgacaagatccccatgaccaactca
cccctgctggaccccctgcccaacctcaagatcaaggtctacagctcgggcaccaccggc
tctgcaccgggcctgccggatggggccgacctgctgggggtcctcccacccggcacctac
cctggcgaattcccccgcgacgcccacttcctgcacctgcgcagtgccagcctcggctcc
cagcagctgctcggtctgccccgcgacccagggagcagcgtcagcggcacctttggctgc
ctgggcgggaggctcagcatccctggcacaggagtcagcctgctggtgcccaatggagcc
atcccccagggcaagttctacgagatgtaccttctcatcaacacggcagagagcaccctc
ccactctcagaagggacccagacagtattgagcccctcggtgacctgcgggcccacgggc
ctcctgctgtgccgccccgtcatcctcagcgtcccccactgcgcccaagtcagtgctggc
gactggatcttccagctcaagacccaggcccaccagggccactgggaggaggtggtgacc
ctggacgaggagaccctcaacaccccctgctactgccagctggaggccagctcgtgccac
atcctgttggaccagctgggcacctacgtgctcactggcgagtcctattcccgctcagcg
gtcaagcggctgcagctggccatcttcgcccctgccctgtgcacctccctggagtacagc
ctcagggtctactgcctgcaggacacgcctgtggccctcaaggaggtgctggagctggag
cggacgctgggcggctacctggtggaggagcccaaacccctgctgttcaaggacagttac
cacaacctgcgcctctccctccacgacatcccgcacgcccactggaggagcaagctgctg
gccaagtaccaggagatccccttctgtcacgtgtggggcggcagcccgaaggctctgcac
tgcacgttcaccctagagaggcacagcctggccgccacggagttcagctgcaagatctgt
gtgcggcaggtggaaggagagggccagatcttccagctgcacaccacgctggcagagacg
ccagcaggctccctggacgccctctgctctgcccctggcagcgccgtgaccacccagctg
ggaccgtacgccttcaagatcccgctgtccatccgccagaagatatgcaacagccttgat
gcccccaacgcgcggggcaacgactggcggctgctggcacagaagctctccatggaccgg
tacctgaattactttgccaccaaagccagccccacgggcgtgatcctggacctctgggaa
gcgctgcagcaggacgacggggacctcaacagcctggccagtgccttggaggagatgggc
aagagtgagatgctggtggccatggccaccgacggcgactgctga

KEGG   Oryctolagus cuniculus (rabbit): 100339802
Entry
100339802         CDS       T03373                                 
Symbol
UNC5D
Name
(RefSeq) unc-5 netrin receptor D
  KO
K07521  netrin receptor unc-5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100339802 (UNC5D)
SSDB
Motif
Pfam: UPA ZU5 Death I-set TSP_1 Ig_3 TSP1_spondin ig Ig_2 TSP1_ADAMTS V-set
Other DBs
NCBI-GeneID: 100339802
NCBI-ProteinID: XP_002709586
Ensembl: ENSOCUG00000017691
UniProt: A0A5F9D9P1
LinkDB
Position
2:complement(71997500..72579217)
AA seq 953 aa
MGRSAAAGGGGAGARRWLQWLGLCFWAAGAAAARGADSGEALPDSIPSAPGTLPHFIEEP
DDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEESLDESSGLKVREVFINVTR
QQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHC
RPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKR
RSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT
CTSLCPVDGSWELWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCI
LDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVVGVTLYRRSQSDYGVDVIDSSAL
TGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSD
IKVKVQSSFMVSLGVSERADYHGKNHPGTFPHGNNRSFTTMHPRNKAPYIQNLSSLPTRT
ELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLS
PEVTCGPPDMVVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCL
LDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAF
QEVVSDERHHGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWS
SNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAV
ILNLWEARHQHDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL
NT seq 2862 nt   +upstreamnt  +downstreamnt
atggggaggtcggcggcggcaggaggcggcggtgcaggggcgcgccggtggctccagtgg
ctggggctctgcttctgggcggcgggggctgcggctgcccgaggagccgacagtggtgaa
gcccttcccgattccatcccatcggctccagggacgctgccccatttcatagaagagcca
gatgatgcttacatcatcaagagcaacccgattgcgctcaggtgcaaggccaggccggcc
atgcagatattcttcaaatgcaacggcgagtgggttcaccagaacgagcatgtctcggag
gagagtctggacgagagctcaggcttgaaggttcgggaggtgttcatcaacgtcaccaga
cagcaggtggaggacttccacgggccggaggactactggtgccagtgtgtggcctggagc
cacctgggcacctccaagagcaggaaggcttctgtgcgcatagcctatttacggaaaaac
tttgagcaagatcctcaaggaagggaggttcccattgaaggcatgatcgtgttgcactgc
cgcccaccagagggcgtccctgcagctgaggtggagtggctgaaaaatgaggagcccatt
gactctgaacaagatgagaacattgacaccagggctgaccataacctcatcatcaggcag
gcacggctctcggactctgggaattacacctgcatggcagccaacattgtggccaagagg
aggagtctgtccgccactgtggtggtctatgtgaatggaggctggtcttcctggacagag
tggtcagcctgcaatgtccgctgtgggagaggatggcagaaacgctcccggacctgcacc
aacccggctcctctcaatggtggggccttttgtgagggaatgtcagtgcagaaaataacc
tgcacctccctttgtcctgtggatgggagctgggaactgtggagcgaatggtcggtctgc
agcccagagtgtgagcacttgcgcatccgggagtgcacagcaccacccccgaggaatggg
ggcaaattctgcgaaggtctgagccaggagtcggagaactgcacagacgggctctgcatt
ctagataaaaaacctcttcatgaaataaaaccccaaagcattgagaatgccagcgacatc
gctctgtactcgggcttgggtgctgccgtcgtggccgttgctgtcctggttgttggggtc
accctctacagacggagccagagtgactacggcgtggacgtcattgactcttctgcattg
acaggtggcttccagaccttcaacttcaaaacagtccgtcaaggtaactctctgctcttg
aattctgccatgcaaccagatctgaccgtaagcaggacatacagtggtcccatctgtcta
caggatcctctggacaaggaactcatgacggaatcctcactcttcaaccctttgtcagac
atcaaagtcaaagtccagagctcattcatggtctccctaggtgtgtcagagagagccgac
taccatggcaagaatcatccggggacttttccccatggaaacaaccggagctttactaca
atgcatcccagaaacaaagctccctacatccaaaacctgtcatctctccccacaagaacg
gaactgaggacaacgggtgtctttggccatttaggagggcgcttagtcatgcccaacaca
ggggtgagcttactaataccacatggtgccatcccagaggagaattcttgggagatttat
atgtccatcaaccaaggtgaacccagcctgcagtcagacgggtctgaggtgcttctgagt
cctgaggtcacctgtggccccccagacatggtcgtcaccactccctttgcactgaccatt
ccacactgtgctgacgtcagctctgagcactggaacatccacttgaagaagcggacacaa
cagggcaagtgggaggaagtgatgtcagtggaggatgaatccacatcctgttactgcctt
ttggaccccttcgcgtgtcacgtgctcctagacagctttgggacgtacgccctcactggg
gaacccatcacagactgtgccgtgaagcagctcaaggtggcggtgtttggctgcatgtcc
tgtaactccctggattacaatctgagagtttactgcgtggacaatacaccttgtgcattt
caggaagtggtttccgatgaaaggcatcacggtgggcagctcctggaggaaccaaagttg
ctgcatttcaaaggcaacaccttcagcctgcagatctctgtcctcgacattcctccattc
ctctggaggattaaaccattcaccgcatgccaggaagtcccgttctcccgcgtgtggagc
agtaaccggcagcccctgcactgtgccttctccttggagcgctacacgcccaccactacc
cagctgtcctgcaaaatctgcatccggcagctcaaaggccatgaacagatcctccaagtg
cagacatcgatcctagagagtgaaagagaaaccatcactttctttgcacaagaggacagc
actttccctgcacagactggccccaaagccttcaaaatcccctactccatcagacagagg
atttgtgctacatttgatacccccaatgccaaaggcaaggactggcagatgttagcacag
aagaacagcatcaacaggaatttgtcttattttgctacacaaagtagcccatctgctgtc
attttgaacctgtgggaagctcgtcatcagcacgatggtgaccttgactccctggcctgt
gcccttgaagagattgggaggacacacacgaaactctcgaacatttcggaatcccagctt
gatgaagccgacttcaactacagcaggcaaaatggactctag

KEGG   Oryctolagus cuniculus (rabbit): 100340738
Entry
100340738         CDS       T03373                                 
Symbol
UNC5A
Name
(RefSeq) unc-5 netrin receptor A
  KO
K07521  netrin receptor unc-5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100340738 (UNC5A)
SSDB
Motif
Pfam: UPA ZU5 Death Ig_3 I-set Ig_2 ig TSP1_spondin TSP_1
Other DBs
NCBI-GeneID: 100340738
NCBI-ProteinID: XP_017196759
LinkDB
Position
3:57303592..57363624
AA seq 846 aa
MAVRPGLWPALLGIVFASWLGGSGAQPSATVANPVPNPVPGANPELLPHFLVEPEDVYIV
KNKPVLLVCKATPATQIFFKCNGEWVRQVDHAIERSTDSSSGLPAMEVRINVSRQQVEKV
FGLEEYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFELEPLAKEVSLEQGIVLPCRPPEGV
PPAEVEWLRNEDLVDPALDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAA
VIVYVDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGADLDTRNCTSDLCVHT
ASGPEDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPS
KADNPHLLTIQPDLSTTTTTYXGSLCPRQDGPSPKFQLTNGHLLSPLSGGRHTLHHSSPT
AEAEDFVSRLSTQNYFRSLPRGTSNMAYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIY
EIYLTLHKPEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLK
KQSCEGSWEDVLHLGEESPSHLYYCQLEAGACYVFTEQLGRFALVGEALSVAAAKRLKLL
LFAPVACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRLLHFKDSYHNLRLSV
HDVPSSLWKSKLLVSYQEIPFYHIWNGTQQYLHCTFTLERVSPSTSDLACKVWVWQVEGD
GQSFNINFNITKDTRFAELLALESEGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGAD
WRTLAQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPEAGLFT
VSEAEC
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggccgtccggcccggcctgtggccagcgctcctgggcatcgtcttcgcctcctggctc
ggcggctcgggtgcccagccgagtgccacggtggccaaccctgtgcccaaccccgtgccc
ggcgccaaccctgagctgctcccccacttcctggtggagccagaggacgtgtacatcgtc
aagaacaagcctgtgctgttggtgtgcaaggccacgcccgccacgcagatcttcttcaag
tgcaacggggagtgggtgcgccaggtggaccatgccatcgagcggagcacggacagcagc
agcgggctgccggccatggaagtccgcatcaatgtctcgaggcagcaggtggagaaggtg
ttcgggctggaggagtactggtgccagtgcgtggcgtggagctcctcgggcaccaccaag
agccagaaagcctacattcgcatcgcctatttacgcaagaacttcgagctggagccgctg
gccaaggaggtgtccttggagcagggcatcgtgctgccctgccgcccgccggagggcgtc
cccccggccgaggtggagtggctgcggaacgaagacctggtggacccagccctggacccc
aacgtgtacatcacgcgggagcacagcctggtggtgcggcaggcccggctggccgacaca
gccaactacacctgcgtggccaagaacatcgtggcgcgccgccgcagcgcctctgcggcc
gtcatcgtctacgtggatggcagctggagcccatggagcaagtggtcagcttgtgggctg
gactgtactcactggcggagccgtgagtgctcggacccagcgccccgcaacggaggcgag
gagtgccagggcgctgacctggacacccgcaactgcaccagtgacctctgcgtgcacact
gcgtcgggccctgaggacgtggccctctacgtgggcctcattgccgtggccgtgtgtctc
gtcctgttgctgcttgtcctcatccttgtttactgccgtaagaaagaggggctggactcg
gacgtggctgactcgtccatccttacctcgggcttccagcctgtcagcatcaagcccagc
aaagcagacaacccccacctgctcaccatccagccagacctcagcaccactaccaccacc
tacncaggcagcctgtgtccccggcaggacgggcccagccccaagttccagctcaccaac
gggcacctgctcagccccctgtcgggcggccgccacacgttgcaccacagctcgcccacc
gctgaggccgaggacttcgtgtcccgcctgtccacccagaactacttccgctccctgcct
agaggcaccagcaacatggcctacgggaccttcaacttcctcggggggcggctgatgatc
cctaacacaggaatcagcctcctcatccccccagatgccatcccccggggaaagatctac
gagatctacctcacgctgcacaagcccgaggatgtgaggttgcccctagccggctgtcag
accctgctgagtcccatcgttagctgcgggccccccggagtcctgctcacccgacctgtg
atcctcgccatggaccactgcggggagcccagccccgacagctggagcctccgcctcaaa
aagcagtcgtgcgagggcagctgggaggatgtgctgcacctgggcgaggagtcaccctcc
cacctctactactgccagctggaggccggcgcctgctacgtcttcactgagcagctgggc
cgcttcgccctggtgggcgaggccctcagcgtggcggcggccaagcgcctcaagctgctt
ctgtttgcccccgtggcctgcacctcccttgagtacaacatccgagtctactgcctacac
gacacccacgatgcactcaaggaggtggtgcagctggagaagcagctgggcggacagctg
atccaggagccccgcctcctgcacttcaaggacagctaccacaacctgcgcctgtctgtg
cacgacgtgcccagctccctgtggaagagcaagctcctggtcagctaccaggagatcccc
ttttaccacatctggaatggcacgcaacagtacctgcactgcaccttcaccttggagcgc
gtcagccccagcaccagtgacctggcctgcaaggtgtgggtgtggcaggtggagggcgac
gggcaaagcttcaacatcaacttcaacatcaccaaggacacgaggtttgctgagctgctg
gctctggagagtgaagggggggtcccagccctggtgggtcccagtgccttcaagatcccc
ttcctcattcggcaaaagatcattaccagcttggacccgccctgcagccggggtgccgac
tggcggaccctggcccaaaaactccacctggacagccatctcagcttcttcgcctccaag
cccagccccacagccatgatcttgaacctgtgggaggcccggcacttccccaacggcaac
ctcagccagctcgcggcagccgtggccggactgggccagcccgaggccggcctcttcacc
gtgtcggaggccgagtgctga

KEGG   Oryctolagus cuniculus (rabbit): 100351024
Entry
100351024         CDS       T03373                                 
Symbol
UNC5C
Name
(RefSeq) unc-5 netrin receptor C
  KO
K07521  netrin receptor unc-5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100351024 (UNC5C)
SSDB
Motif
Pfam: UPA ZU5 Death Ig_3 I-set TSP1_spondin TSP_1 Ig_2 ig TSP1_ADAMTS AtuA
Other DBs
NCBI-GeneID: 100351024
NCBI-ProteinID: XP_008265803
Ensembl: ENSOCUG00000015054
LinkDB
Position
15:54334953..54714595
AA seq 950 aa
MRKGLRATAARCGLGLGYVLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTSWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQSFIYPISTEQRTQNEYGFSSAPDSDDVALYVGIVIAVIVCLAISVVVALFV
YRKNHRDFESDIIDSSALNGGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSD
KIPMTNSPILDPLPNLKIKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALNLKNQS
LARQTDPSCTAFGTFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPM
EDSQTLLTPVVSCGPPGALLTRPVILTMHHCADPDTEDWKIQLKNQVAQGQWEDVVVVGE
ENFTTPCYIQLDAEACHILTENLSTYALVGQSTNKAAAKRLKLAIFGPLCCSSLEYSIRV
YCLDDTQDALKEVLQLERQMGGQLLEDPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKY
QEIPFYHIWSGSQRNLHCTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTG
MDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNY
FATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAEGQY
NT seq 2853 nt   +upstreamnt  +downstreamnt
atgaggaaaggtctgcgggctacagcggcccgctgcggactgggactgggatatgtgctg
caaatgctcgtgctacctgccctggccctgctcagcgccagcggcacgggctctgccgct
caagacgatgacttttttcacgaactcccagaaacctttccatccgatccacctgagcct
ctaccacacttccttattgagcctgaggaagcttacattgtgaagaacaagcctgtgaac
ctgtattgtaaagccagtcctgccacccaaatctacttcaagtgcaacagtgaatgggtg
catcagaaggaccacatagtagatgagagagtagacgaaacatctggtctcattgtccgg
gaggtgagcattgaaatttcacgccagcaagtggaggaactctttggacctgaggattac
tggtgccagtgtgtggcctggagctcagcaggcaccacgaagagccggaaagcctacgta
cgcattgcatatctgcggaagacatttgagcaggaacccctgggaaaggaagtatcctta
gaacaagaagtcttactccaatgccggccacccgaagggatcccagtggctgaggtggag
tggttgaaaaacgaagacataattgatcctgttgaagaccggaacttttacattactatt
gatcataacctcatcataaagcaggcccgcctctctgatactgcgaattatacctgtgtt
gctaaaaacattgttgccaagagaaaaagtacaactgccactgtcatagtttatgtgaat
ggtggttggtccacctggacagagtggtcggtgtgtaacagtcgctgtggacgagggtat
cagaaacgtacaaggacctgcaccaacccagcaccactcaatggtggtgccttctgcgaa
gggcagagtgtccagaaaatagcctgtaccacattgtgtccagtggatggcaggtggacc
tcatggagcaagtggtctacatgcggcacagagtgcacccactggcgcaggagggagtgc
acggcaccagcccccaagaatggaggcaaggactgtgacggcttggtcttgcaatccaag
aactgcacggatgggctctgcatgcagagtttcatttatcctatttcaactgaacagaga
acccagaatgaatatggattttcttctgctcctgactccgatgacgttgctctctatgtt
ggaattgtgatcgcggtgatagtgtgcctggcgatctctgtagtcgtggccctatttgtt
tatcggaagaatcaccgagacttcgagtctgacattattgactcgtcggcactcaatgga
ggctttcagcctgtgaacatcaaggcagcaagacaagatcttctggcagttcccccagac
ctcacttcagctgcagccatgtacaggggacctgtctatgccctacatgacgtctcagac
aaaatcccaatgaccaattctccaattctggatccactgcccaacctgaaaatcaaagtg
tacaacacgtcaggtgctgtcactccccaagatgacctctctgagtttacgtccaagctg
tccccgcagatgacccaatccttgttggaaaacgaagctctcaacctgaagaatcagagc
ctagccaggcagacagatccatcctgcactgcgtttggcaccttcaactccctcgggggt
cacctcatcgttcccaactcaggagtaagtctgctgattcctgccggggccattccccaa
gggagagtctacgaaatgtatgtgacggtacacaggaaagaaaatatgaggccacccatg
gaagactcacagacacttctgacgcctgtggtgagctgtgggcctccaggagctctgctg
acacgccccgtcatccttaccatgcatcactgcgcagatcctgacacggaggactggaag
attcaactcaagaaccaggtggcacagggccagtgggaggacgtggtggtggtcggagag
gaaaacttcactaccccttgctacattcagctggatgcagaggcctgccacatcctcaca
gagaacctcagcacctatgccctggttggccagtccaccaacaaggcagctgcaaagcga
ctgaagctggccatctttgggcccctctgttgctcctccctggagtacagcatccgggtc
tactgtctggatgacacacaggatgccctgaaggaagttctacaacttgagagacagatg
ggaggacagctcctagaggaccccaaggctcttcattttaaaggcagcacccacaacctg
cgcctgtcaattcatgacatcgcccattcactctggaagagcaaactgctggctaagtat
caggagattcctttttatcatatctggagtgggtctcaaagaaacctccactgcaccttc
actctggaaagattcagcctgaacacagtggagctggtttgcaagctctgtgtgcggcaa
gtggaaggagagggacagatcttccagctcaactgcaccgtgtcagaggaacctacaggc
atggatttgccactgctggaccctgcgagtaccatcaccaccgtcacggggccgagcgcc
ttcagcattcctctcccgatccggcagaagctttgtagcagcctggatgccccacagact
agaggccatgactggcggatgctggcccataagctaaacttggacaggtacttgaattac
tttgccaccaaatcaagcccaactggtgtaatcctggatctttgggaagcacagaacttc
ccggatggaaacctgagcatgctggcagctgtcttggaagaaatgggacgacacgaaacg
gtagtgtcgttagcagctgaagggcagtactga

DBGET integrated database retrieval system