KEGG   Oryctolagus cuniculus (rabbit): 100338432
Entry
100338432         CDS       T03373                                 
Symbol
CCR7
Name
(RefSeq) C-C motif chemokine receptor 7
  KO
K04182  C-C chemokine receptor type 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100338432 (CCR7)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100338432 (CCR7)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    100338432 (CCR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100338432 (CCR7)
   04050 Cytokine receptors [BR:ocu04050]
    100338432 (CCR7)
   04090 CD molecules [BR:ocu04090]
    100338432 (CCR7)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100338432 (CCR7)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100338432 (CCR7)
CD molecules [BR:ocu04090]
 Proteins
  100338432 (CCR7)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF621
Other DBs
NCBI-GeneID: 100338432
NCBI-ProteinID: XP_002719405
Ensembl: ENSOCUG00000025569
UniProt: G1TKJ1
LinkDB
Position
19:complement(41675664..41685295)
AA seq 378 aa
MDLGKPMKSLLVVALLVVFQVCLCQDEVTDDYIGDNTTVDYSLFEYVCFKKDVRNFKAWF
LPVMYSAICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNLAVADILFLLTLPFWAYSAAK
SWIFGVHFCKLLFGIYKVSFFSGMLLLLCISIDRYVAIVQAVSAHRHRARVLLISKLSCV
AIWLLAVLLSTPELLYSGLQKSSSEQALRCSLITQNVEALIVIQVAQMVIGFLVPLLVMS
SCYLVIIHTLLQARNFERNKAIKVIIAVVVVFTVFQLPYNGVVLAQTVANFNTTSSNCEL
SKQLNIAYDVTYSLACFRCCVNPFLYAFIGVKFRNDLFKLFKELGCLSQERLRQWSSCRH
TRRASMSVEAETTTTFSP
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggacctggggaagccgatgaaaagcctgctggtcgtggcactccttgtggtcttccag
gtgtgcctgtgccaggacgaggtgacagatgactacatcggggacaacaccacggtggac
tactcgctcttcgagtacgtgtgcttcaagaaggatgtgcggaactttaaggcctggttc
ctccccgtcatgtactcggccatctgcttcgtggggctgctgggcaacgggctggtggtg
ttgacctacatctacttcaagaggctcaagaccatgaccgacacctacctgctcaacctg
gccgtggccgacatcctcttcctcctgacgcttcccttctgggcctacagcgcggccaag
tcctggatcttcggcgtccacttttgcaagctcctcttcgggatctacaaggtcagcttc
ttcagcggcatgctcctgctcctgtgcatcagcatcgaccgctacgtggccatcgtgcag
gccgtctcggcccaccgccaccgggcccgcgtgctgctcatcagcaagctctcctgtgtg
gccatctggctgctggccgtgctgctgtccaccccggagctgctctacagtggccttcag
aagagcagcagcgagcaggccctgcggtgctccctcatcacccagaacgtggaggccttg
atcgtcatccaggtggcccagatggtgatcggcttcctggtgcccctgctggtcatgagc
tcctgctacctcgtcatcatccacaccctgctgcaggcacgcaacttcgagcgcaacaag
gccatcaaggtgatcatcgccgtggtggtggtcttcacggtcttccagctgccctacaac
ggggtggtcctggcccagacagtggccaatttcaacaccaccagcagcaactgtgagcta
agcaagcagctcaacatcgcctacgatgtcacctacagcctggcctgcttccgctgctgc
gtcaaccctttcctgtacgccttcatcggcgtcaagttccgcaacgacctcttcaagctc
ttcaaggaactgggctgtctcagccaggagcggctccggcagtggtcttcctgccggcac
acccggcgggcctcgatgagcgtggaggctgagaccaccaccaccttctccccgtag

KEGG   Oryctolagus cuniculus (rabbit): 100352521
Entry
100352521         CDS       T03373                                 
Symbol
ACKR4
Name
(RefSeq) atypical chemokine receptor 4
  KO
K04186  atypical chemokine receptor 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100352521 (ACKR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100352521 (ACKR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ocu04030]
    100352521 (ACKR4)
   04050 Cytokine receptors [BR:ocu04050]
    100352521 (ACKR4)
G protein-coupled receptors [BR:ocu04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    100352521 (ACKR4)
Cytokine receptors [BR:ocu04050]
 Chemokine receptors
  CC Chemokine
   100352521 (ACKR4)
SSDB
Motif
Pfam: 7tm_1 DUF621 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 100352521
NCBI-ProteinID: XP_002716461
Ensembl: ENSOCUG00000016560
UniProt: G1TBW3
LinkDB
Position
14:27461947..27467802
AA seq 350 aa
MALEQNQSTDYYYEENELNGTHDYSLYEAICIKEEVRQFAKVFLPVFFTITFITGLAGNS
TVVAIYAYYKKQRTKTDVYILNLAVADLLLLFTLPFWAVNAVHGWVLGKVMCKVTSALYT
VNFVSGMQFLACISIDRYWAVTKVPGPAGAGRPCWLICLCVWLAATLLSSPQLVFYTVND
NARCIPVFPHQLGTSVKASVQMLEICIGFVIPFLIMGVCYFITARTLIKTPNIKKSRPLK
VVLAVVLVFIVTQLPYNVVKFCQAVDIIYSLITDCDASKRLDVAIQVTESIALFHSCLNP
ILYVFMGASFKNYIMKVAKKYGSWRRQRQNAEEIPFDSEGPTEPTSTFSI
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcgttggagcagaaccagtcaacagattactactacgaggagaatgagctgaatggc
acgcacgactacagcctgtacgaagctatctgcataaaggaagaggtgagacagtttgca
aaagttttcctccctgtcttcttcaccatcactttcatcactggacttgctggcaactcc
accgtagtggccatctatgcctattacaagaaacagcgcaccaaaaccgatgtgtacatc
ttgaacttggccgtggctgatttactcctgctgtttaccctacctttctgggcagtcaat
gcggttcacgggtgggttctaggtaaagtgatgtgcaaggtgacgtcggccttgtacaca
gtcaactttgtctcaggaatgcagttcctggcttgtatcagcatcgacagatattgggca
gtaaccaaagtccccggcccagcgggggcgggaaggccgtgctggctcatctgtctctgc
gtctggctggccgctaccttgctgagcagcccccagctggtgttttacacggtcaacgac
aatgcccgctgcatccccgtctttccccaccagctgggaacctcggtgaaagcatcggtc
cagatgctggagatctgcatcgggttcgtgataccctttctcatcatgggggtgtgttac
ttcattacggcaagaacgctcatcaagacgccgaacattaagaaatcccgacccctcaaa
gttgtgctcgccgtggttctagttttcatcgtaacgcagctgccttacaacgtcgtcaag
ttctgccaagccgtggacatcatctactccctgatcaccgactgcgacgccagcaagcgc
ctggacgtcgccatccaggtcaccgagagcattgcgctcttccacagctgcctcaacccc
atcctctacgtcttcatgggcgcctcttttaaaaactacatcatgaaagtggccaagaaa
tacgggtcctggagaagacagcgacaaaacgcagaggagattcctttcgattccgagggc
cctacagagccgaccagtaccttcagcatttaa

DBGET integrated database retrieval system