KEGG   Oryctolagus cuniculus (rabbit): 100338505
Entry
100338505         CDS       T03373                                 
Symbol
CHMP2B
Name
(RefSeq) charged multivesicular body protein 2B
  KO
K12192  charged multivesicular body protein 2B
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04217  Necroptosis
ocu05014  Amyotrophic lateral sclerosis
ocu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100338505 (CHMP2B)
  09143 Cell growth and death
   04217 Necroptosis
    100338505 (CHMP2B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100338505 (CHMP2B)
   05022 Pathways of neurodegeneration - multiple diseases
    100338505 (CHMP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338505 (CHMP2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100338505 (CHMP2B)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100338505 (CHMP2B)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100338505 (CHMP2B)
SSDB
Motif
Pfam: Snf7 DnaJ-X DUF3456 DUF5760
Other DBs
NCBI-GeneID: 100338505
NCBI-ProteinID: XP_008265322
Ensembl: ENSOCUG00000003985
UniProt: G1SKU8
LinkDB
Position
14:complement(129662860..129694987)
AA seq 213 aa
MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKDACRV
LAKQLVHLRKQKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQK
TLQTMQNFQKENMKMEMTEEMINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAK
APSAARSLPSASTSKATISDEEIERQLKALGVD
NT seq 642 nt   +upstreamnt  +downstreamnt
atggcgtccctcttcaagaagaaaaccgtggatgatgtaataaaggagcagaatcgagaa
ttacgaggtacacagagagctataatcagagatcgagcagctttagagaaacaagaaaaa
cagctggaattagaaattaagaaaatggccaagatcggtaataaagatgcttgtagggtt
ttagccaaacagcttgtacatctacggaaacagaaaacaagaacttttgctgtaagttca
aaagtcacttctatgtccacacaaacaaaagtgatgaattctcagatgaagatggctggt
gcgatgtctaccacagcaaaaacaatgcaggcagttaacaagaagatggatccacaaaag
acattacaaacaatgcagaatttccagaaggaaaacatgaaaatggaaatgactgaagaa
atgatcaatgacacacttgatgacatctttgatggctctgatgatgaagaagaaagccag
gatattgtgaatcaagttcttgatgaaattggaattgaaatctctgggaagatggccaaa
gctccatcagctgccagaagcttaccatctgcctctacttcaaaggctacaatctccgat
gaagagattgaacggcaactgaaagctttaggagtagattag

KEGG   Oryctolagus cuniculus (rabbit): 100340798
Entry
100340798         CDS       T03373                                 
Symbol
CHMP2A
Name
(RefSeq) charged multivesicular body protein 2A
  KO
K12191  charged multivesicular body protein 2A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100340798 (CHMP2A)
  09143 Cell growth and death
   04217 Necroptosis
    100340798 (CHMP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100340798 (CHMP2A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100340798 (CHMP2A)
Membrane trafficking [BR:ocu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    100340798 (CHMP2A)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100340798 (CHMP2A)
  Exosomal proteins of other body fluids (saliva and urine)
   100340798 (CHMP2A)
  Exosomal proteins of colorectal cancer cells
   100340798 (CHMP2A)
SSDB
Motif
Pfam: Snf7
Other DBs
NCBI-GeneID: 100340798
NCBI-ProteinID: XP_002721945
Ensembl: ENSOCUG00000016621
UniProt: G1TC07
LinkDB
Position
Un
AA seq 222 aa
MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLEMQEKKIIADIKKMAKQGQMDAVR
IMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLP
QIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELS
NLPSTGGSLSVAAGGKKAEATASALADADADLEERLKNLRRD
NT seq 669 nt   +upstreamnt  +downstreamnt
atggacctgctgttcgggcgccggaagacaccagaagagctgcttcggcagaaccagagg
gccttgaaccgcgcgatgcgggagctggaccgtgagcggcagaagctggagatgcaggaa
aagaagatcattgcagacatcaagaagatggccaagcagggccagatggatgccgtgcgt
atcatggcaaaagaccttgtgcgcaccaggcgctatgtgcgcaagtttgtgttgatgcga
gccaacatccaagcagtgtctctcaagatccagaccctcaagtccaacaactcaatggca
caagccatgaagggagtcaccaaggccatgggcaccatgaacagacagctgaaactgccc
cagatccagaagatcatgatggagtttgagcggcaggcagagattatggacatgaaggag
gaaatgatgaacgatgccattgatgatgccatgggtgatgaggaggatgaagaggaaagc
gatgcggtcgtgtctcaagtcctggacgaactgggactgagcctgacggatgaactgtcg
aacctcccgtccactggaggatcactcagtgtggctgctggtgggaagaaggcagaggct
acagcctcagccctggctgatgccgacgcagacctagaggagcgcctcaagaacctgcgg
agggactga

DBGET integrated database retrieval system