KEGG   Oryctolagus cuniculus (rabbit): 100338777
Entry
100338777         CDS       T03373                                 
Symbol
NXF3
Name
(RefSeq) nuclear RNA export factor 3
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  Nucleocytoplasmic transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100338777 (NXF3)
   03015 mRNA surveillance pathway
    100338777 (NXF3)
   03008 Ribosome biogenesis in eukaryotes
    100338777 (NXF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100338777 (NXF3)
   05168 Herpes simplex virus 1 infection
    100338777 (NXF3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100338777 (NXF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100338777 (NXF3)
   03009 Ribosome biogenesis [BR:ocu03009]
    100338777 (NXF3)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100338777 (NXF3)
   mRNA cycle factors
    Stress granule specific factors
     100338777 (NXF3)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100338777 (NXF3)
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2
Other DBs
NCBI-GeneID: 100338777
NCBI-ProteinID: XP_008271340
Ensembl: ENSOCUG00000008684
LinkDB
Position
X:86887147..86907739
AA seq 610 aa
MGHNRQINSQRRRPGCLHFYHRRLLNCPEMVRSGMYLSSQQQQEGNPATSDAQVDSQIRY
APYAISSYRRRGSFRKQYQTRGKMEKEQNLPERRMEGTQGGISSNWFKITIPFGIKYNEQ
WLLDLIQRQCSIPFRPVEFHYDKMQAHFFVENSCIASALKNISGKIWDENHEGISIFVTP
SEVPRSVQEELKLEKVEQIKLTTNIQGDASQQPADIKNLSSDPDLMAHNIEMASNPRMCE
ASSLQIHEENMPKVLTLDPSHNPTYLLVGRPGTAQKATNINNVNISKTEVKSLGKTDKEK
GLDPEKMRMDRNPQGATCPDKSSNINSILELFPKLLSLDGPKSPGTLCGTEANKMLPTSK
GSFFGSEILKNVILQFLQQYYLFYDYGDRCSLLGAYHDEACFSLTVPFNSMDLIPSSLCE
YLKNSRNIKNVTDRHLRRQLLQHTNHAIVDVLRVLPKTQHDFSSFLVDMWFQTETMLCFS
VNGVFKEVEGDSQGCVWAFTRTFITIPTSNSSLCIMNDKLFMQNTRTREPQSAFSISVPT
PCSSSMPTLSQAQQEMVQALSIQYGVNLEWSQKCLHDNNWDYARAAQFLTLPKVKGKMPG
EPLKQADPRS
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgggacacaatcgccaaattaattcccaacgaagaagaccaggatgcttgcatttttac
cacagaagattgcttaattgccctgagatggttcgttctggcatgtatctttcatcccag
cagcagcaagaaggaaatccagcaacaagtgatgcccaggtggattcacaaataagatac
gctccctatgccatttcatcctatcgtcggagaggtagttttcgtaaacaataccaaact
cgtggtaagatggagaaagaacaaaatcttccagagagaagaatggaggggacacagggt
gggatttcgagcaactggttcaagatcacaattccatttggcataaaatataatgagcag
tggctattggacttgattcagagacagtgcagtatcccattcaggccggttgagtttcac
tatgataaaatgcaagcccacttctttgttgagaattcctgtattgcctctgctttgaag
aatatcagtggcaagatttgggacgagaatcacgaagggatatcaatcttcgtcactccc
tctgaggtaccccgctctgtgcaggaggagttgaaattggaaaaagtggaacagattaag
ctgactacaaacatacaaggtgatgcctcccagcaacctgctgacatcaagaacctcagc
tctgacccagacttgatggcccataatattgaaatggcatcaaatcctagaatgtgcgag
gcttcctccctgcaaatccatgaagagaacatgcccaaggttttgactttggacccaagt
cacaatccaacctatctgctggttggccggcctggcactgcacaaaaggctacaaacatc
aataatgtgaatatctccaaaactgaggtgaagtctttggggaagacggacaaggagaaa
gggctggatccagaaaaaatgcgtatggacagaaacccccagggtgccacctgcccggat
aagtccagcaacataaactctatcctagaattgttccccaagttattaagcctggatggc
ccaaagtcacctggaaccctctgtggcacggaagcgaacaagatgttaccaactagcaag
ggaagcttcttcggatctgagatactgaagaacgtgatcctgcagtttctgcagcagtat
tacttgttctatgactatggagatcgctgtagtcttcttggtgcttaccatgatgaggcc
tgcttctccctgaccgttcccttcaactccatggatctgatcccgagcagtctgtgtgag
tatttgaagaacagcaggaatatcaagaatgtcacggaccgccacctgcgaaggcaactg
ctgcaacacacaaaccatgccattgtggatgtcctccgtgtgttacccaaaactcagcat
gacttcagctccttcttggtggacatgtggttccagacggaaactatgctctgcttttct
gtcaacggggtgttcaaggaagtggaaggagattctcagggatgtgtttgggctttcact
cggaccttcatcactatccctaccagcaattccagcctgtgcatcatgaatgacaagctg
tttatgcagaacaccagaacccgagagcctcagagtgccttctccatctcagtgcccaca
ccctgctccagctccatgcctactctctctcaggcacagcaagaaatggtgcaggctttg
tccattcagtatggagtgaacctcgagtggtctcagaaatgtcttcatgacaacaactgg
gattatgccagagctgctcagtttctcactctgcccaaggtcaagggcaagatgccaggg
gagcctctcaaacaggctgatccaagatcatga

KEGG   Oryctolagus cuniculus (rabbit): 100339773
Entry
100339773         CDS       T03373                                 
Name
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  Nucleocytoplasmic transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100339773
   03015 mRNA surveillance pathway
    100339773
   03008 Ribosome biogenesis in eukaryotes
    100339773
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100339773
   05168 Herpes simplex virus 1 infection
    100339773
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100339773
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339773
   03009 Ribosome biogenesis [BR:ocu03009]
    100339773
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100339773
   mRNA cycle factors
    Stress granule specific factors
     100339773
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100339773
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_8 LRR_4
Other DBs
NCBI-GeneID: 100339773
NCBI-ProteinID: XP_008271331
Ensembl: ENSOCUG00000005789
UniProt: G1SPN8
LinkDB
Position
X:complement(87139367..87155215)
AA seq 592 aa
MESNNGGGCPQGKKKDDEDSLQGKFDHGNFHYEHAVGELLSSNLQEDRNRMMRDVHENPQ
LRRSMECHYEHQDRILPEGAVTANTDNEALRKLFKITIPYGIKYEKTWLINSIQSYCSVP
FTPINLRYVRNQVEFFVQDASTASTLEDINYKIYDEENQKISILVEPSTETHSVQTNLKP
EQMEVLMLTMNKRYDVSQKALDLQSLSFDRDLVGHETDMILDERKCMTAALQIIEKNFSE
LLSLNLCNNKLYQLDGLSDIIGKVPKVKILNLSANELRTAWELEKVKELDLEELWLEGNP
LCRTFPSHAAYVRAIRNCFPKLLRLDGKELPPIAIDMEVPEIIKPCKESYKGSETLKSLI
LQFLLRYYVIYDSGDRRGLFGAYHEKACFSLTIPFNCGDPFSLWEYFKYSRNMKKLKDPY
LRRQLLKHTKHDIVNSLSVLPRTQHDFSSCVVDLCFQTEMMLCFSVSGVFKELEGKSPGI
VRAFTRIFILASVSSSSICIVNDKLIVRNASPKETQSAFSTPLPSCFSSSVPTLSQEKME
MVKAFSTQSGMNLEWSQKCLEDNEWNYATAAQIFTMLQRQGRIPEEAFKQIP
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggaatccaataatggtggtggctgtcctcaaggaaaaaagaaagatgatgaagattct
ttgcaagggaaatttgaccatgggaactttcattatgaacatgctgtgggtgagcttctg
tcttcaaacctccaggaggatcgaaacaggatgatgagggatgtccatgagaacccccag
ctaagacggagcatggaatgccattatgaacatcaagatagaattcttccagagggagct
gtgacagcaaatacagataatgaagccctgaggaaattgttcaagataacaattccctac
gggataaagtatgagaagacatggctaattaattcaatccagagctattgcagtgtccct
ttcaccccaatcaacctcaggtatgtcagaaatcaagtggagttctttgttcaggatgct
agcactgcctcgacattggaggatatcaactacaagatttatgatgaggaaaatcaaaag
atatctatccttgttgaaccttccactgaaactcattctgtgcagactaacttaaagcca
gagcaaatggaggtgctaatgttgaccatgaacaaacgatatgatgtttcccagaaagct
cttgacctccagagcctcagctttgaccgagacttggtaggccatgaaactgacatgatc
ttggatgaaagaaaatgtatgactgctgccctgcagatcattgaaaagaatttctctgag
ctgttgtccttgaatttgtgtaacaacaagctgtaccagctggatggcttgtctgacatt
atagggaaggtgcccaaagtcaagatcctgaacctctctgcaaacgagctgaggacagca
tgggaattggagaaggtgaaagagctggatctggaagagctgtggctggaagggaacccc
ttgtgcagaaccttccctagccatgctgcctacgtaagggccatccggaattgtttcccc
aagttattacgcctggatggaaaggagttaccaccaattgcaattgatatggaagtccct
gagataataaaaccttgtaaggaaagctataaaggatctgagaccctgaagagtctcatc
ctgcaatttctgcttcggtattatgtgatttatgactctggagatcgacggggtctcttt
ggtgcttaccatgaaaaggcctgcttctccctgaccatccccttcaactgtggtgatcca
ttcagcttatgggagtactttaagtatagcaggaatatgaagaagctcaaggacccatac
ctgcggaggcagctgctgaagcacacaaagcatgacattgtgaattctctcagtgtcttg
cccagaactcagcatgacttcagctcctgtgtggtggacctgtgttttcagacagaaatg
atgctctgcttttctgtcagtggtgtgttcaaggaattggaaggaaagtccccgggtatt
gttcgtgccttcaccaggatcttcatcttggcttctgtcagcagttccagcatatgcatt
gtgaatgacaagctgattgtgaggaatgccagccccaaagagacccagagtgccttttcc
actcccttgccctcatgcttctccagctctgtgcccaccctctcccaagagaagatggaa
atggtgaaggctttctccacccagtctgggatgaatttggaatggtctcagaagtgcctt
gaagacaacgagtggaactatgccacagctgcgcagatctttactatgctccagaggcag
ggcaggatcccggaggaggccttcaagcaaattccctaa

KEGG   Oryctolagus cuniculus (rabbit): 100340535
Entry
100340535         CDS       T03373                                 
Symbol
NXF2
Name
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  Nucleocytoplasmic transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100340535 (NXF2)
   03015 mRNA surveillance pathway
    100340535 (NXF2)
   03008 Ribosome biogenesis in eukaryotes
    100340535 (NXF2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100340535 (NXF2)
   05168 Herpes simplex virus 1 infection
    100340535 (NXF2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100340535 (NXF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100340535 (NXF2)
   03009 Ribosome biogenesis [BR:ocu03009]
    100340535 (NXF2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100340535 (NXF2)
   mRNA cycle factors
    Stress granule specific factors
     100340535 (NXF2)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100340535 (NXF2)
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_4 LRR_8
Other DBs
NCBI-GeneID: 100340535
NCBI-ProteinID: XP_008271326
Ensembl: ENSOCUG00000015043
LinkDB
Position
X:87270558..87290925
AA seq 617 aa
MSFTQRKSGANQREERSGSSSVHEGRKRSWGSFQGNFSGRNLLYEHSRHEHLRSHRHDDD
GTVAMRNVHQEPQLRRTPNNMQYSKRRLKYNHDHVDAYGSKKCPEGEMEDGTVSCWFKVT
VPNGRKYNKKWLLSSIQSESTVHFTPVDFHYINNQARFFVQYSDTASALKNVSHKICDDE
NRKIPIFVNRSSVPYSVKNKLKPEEMEQLKLTLNKRYDASRQALDLQNLRFDPDLVGHDI
DMILNRRQCMDATLKIIEGNFPELLSLNLCNNKLYQLDGLCDIIENAPKVKILNLSNNEL
KTACELNKLKELNLEELWLEGNPLWRTFPNHSAYVSAMQDCFPNLLRLDGREIASPVVID
VGAPKLVKLSKEIPKGTEMLKSLVLQFLQEYYFIYDYGDRRGLLGTYHDKACFSLTMPFN
SMDPVPSGLFVYLQNSRNIKNVTDPHLRRQLLKHTSRDIVDALSVLPRTKHDFSSFSIDM
WFHTETMLCFSVNGVFKEENGSPDSVFAFTRTFIAIPGSTSSLCITNDQLFVKNVSSSML
QCTSSIPGATPSSSCTPVLSQLQLQMVQSFSTQSGMKIEWSQKCLEENEWNYTRAAQAFI
NLQTQGTIPKEAFQQSV
NT seq 1854 nt   +upstreamnt  +downstreamnt
atgtcatttactcaaaggaagagtggtgcaaaccagcgtgaagaacgcagtggcagcagt
agtgttcatgaaggaagaaagagaagttggggttctttccagggtaatttttctgggagg
aaccttctttatgaacatagtaggcatgagcatttacgttcacaccgccatgatgatgat
ggaactgtagcaatgaggaatgtacaccaggaaccccagttaagacgcactccaaataat
atgcaatacagcaagaggagactgaaatataatcatgaccatgtggatgcgtatggatct
aagaaatgtccagagggagaaatggaggatggaactgtatcatgctggttcaaggtcaca
gttcccaatgggagaaagtataacaagaaatggctgttgagctcaatccagagcgagtcc
actgttcacttcactccggttgattttcattacatcaacaatcaggctcggttctttgtg
cagtattctgacactgcatctgcactgaagaatgtcagccacaagatttgtgatgacgag
aaccgaaagatacctatcttcgtcaaccgctcttctgtaccctactctgtgaagaataag
ttgaagccagaggaaatggagcagctaaagttgaccttgaacaagcgatatgatgcttcc
cggcaagctcttgacctccagaacctccgctttgatccagacttggttggccatgatatt
gatatgattctgaatcgaagacagtgcatggatgccacactgaagatcattgaaggaaat
ttccctgagctgttgtctttgaacttgtgcaacaacaaactgtaccagctggacggcctg
tgtgatattatagagaatgctcctaaagtcaagatcctgaacctctccaacaatgagctg
aagacagcatgtgaattaaacaagctaaaagagctgaatcttgaagagttgtggctagaa
ggcaacccattgtggagaaccttccctaaccactctgcctatgtaagtgccatgcaggac
tgcttccctaatttgttacgcttggatggccgagagattgcctcacctgttgtcattgat
gttggtgctcctaagttagtaaaactctccaaggaaatcccaaaaggaactgaaatgctg
aagagtctcgtcctgcaattcctgcaggagtattacttcatctatgactatggggatcgt
cgtggtctccttggtacttaccatgacaaggcctgcttctccctgaccatgcccttcaac
tccatggacccagtcccgagcggcctgtttgtgtacttacagaacagcaggaatatcaaa
aatgtcacggatccccacttgcgaaggcagctattgaagcacacaagccgtgacatagtg
gatgctctcagtgtgttgccaagaactaaacatgactttagttctttctcaatagacatg
tggttccatacggaaactatgctttgcttttctgtcaacggggtatttaaggaagaaaac
ggttctccggattctgtgtttgccttcacccggaccttcatcgctatccctggcagcact
tccagtctctgcatcacgaatgaccaactgtttgtgaagaacgtcagcagcagcatgttg
cagtgcacctcctccatcccaggagccacaccaagctccagttgcacacccgtactctcc
cagctgcagctgcaaatggtgcagtctttctccacccagtctgggatgaaaattgagtgg
tctcaaaagtgccttgaggagaatgagtggaactacaccagagcagcacaggccttcatt
aacctccagacacagggcacgatcccaaaggaggccttccaacagagtgtctaa

KEGG   Oryctolagus cuniculus (rabbit): 100342837
Entry
100342837         CDS       T03373                                 
Name
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  Nucleocytoplasmic transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100342837
   03015 mRNA surveillance pathway
    100342837
   03008 Ribosome biogenesis in eukaryotes
    100342837
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100342837
   05168 Herpes simplex virus 1 infection
    100342837
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100342837
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100342837
   03009 Ribosome biogenesis [BR:ocu03009]
    100342837
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100342837
   mRNA cycle factors
    Stress granule specific factors
     100342837
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100342837
SSDB
Motif
Pfam: Tap-RNA_bind TAP_C NTF2 LRR_8
Other DBs
NCBI-GeneID: 100342837
NCBI-ProteinID: XP_008271313
Ensembl: ENSOCUG00000004154
LinkDB
Position
X:87595205..87616536
AA seq 650 aa
MLPRKDSKLKASNSKVVLQNTESEKQQQEHAVPSMKYENHENKEHNDDASSPDAGRNVES
SFQDTVGDGNVHDKHSRYEHLPSYLNDDGNTAVRNVHRDSQRRCTPYDVRRNKRTVQWRY
DDQIHITVWREKKSLERQNNKDTKDEATDIWFKVMVPYGKNYDKKWLMNSIQSHCAIPFT
PVDFHYVKNQARFFVQDASTAAALAEVSHKICDNEDKKIPIFVSRSVVPYSVQNKLQPEQ
MEQLKLALSKRYDAFQRSLDLQRLRFDRDLVSHNIDMILNRRNCMAATLEVIQSDFSELV
SLNLSSNKLYQLNGLCDIVEKAPKVKILNLSANKLRTAWELEKVKELDLEELWLEGNPLC
RTFPSHAAYVSAIRDCFPKLLRLDGIVLPLPVGVDTNELQLVEPFPEPPKETEMLKSLIL
RFLQEYYFIYDYGDRRSLLRTYHEKACFSLTIPFDPMDPVPSGLCEYFKDSRNMMYLQDP
YLRRQMLKHTNWDIVNTLNVLPRTQHDFISFSMDMWFQMGTALCFSVNGVFKGGSNSWDS
AFIFTRIFITAPRSSSSLCILNDQLFVRDVMPVIHNSSVLGAIPGSNTMADLNQLQQKMV
QAFYMQSGMKLEWSQKCLEDNGWNYIRAKNIFITLLTQSKIPQEAFRHMP
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgctgccgcgaaaagacagcaaactgaaggccagtaattcaaaggtagttctgcaaaac
actgagtctgagaaacagcaacaggaacatgctgtaccatcaatgaaatatgagaaccat
gaaaataaagaacataatgatgatgcgagctctcctgatgcaggaaggaatgttgagagc
tctttccaggatactgttggtgatggaaacgttcatgataaacacagtagatatgagcat
ctgccctcatacctcaatgatgatggaaatacagcagtgaggaatgtccacagggactct
caaaggcggtgcactccttatgatgtgcgtcgcaacaagaggacagtgcaatggcgctat
gatgaccaaatccatattactgtatggagagagaagaaatctctagagagacaaaataat
aaggacacaaaggatgaagccacggatatctggttcaaggtcatggttccatatgggaaa
aattatgacaagaaatggctgatgaattcaatccagagccattgcgctatccccttcact
ccggttgatttccactacgtcaaaaatcaggcccggttctttgtccaggatgctagcact
gctgctgcattggcagaagtcagccacaagatttgtgataatgaggacaaaaagatacct
atttttgtcagccgctctgttgtaccctactctgtgcagaataagttgcagccagaacaa
atggagcagctaaagctggccctgagcaagcgatatgatgctttccagcgatctcttgac
ctccagagactccgttttgaccgagatttggtaagccataatattgacatgatactgaat
cggagaaactgcatggctgctactctggaggtcattcaaagtgatttctctgagctggtg
tctttgaatttgagcagcaacaaactctaccagctgaatggcctgtgtgacattgttgag
aaggcccccaaagtcaagatcctgaacctctctgcaaacaagctgaggacagcatgggaa
ttggagaaagtgaaagagctggatctggaagagctgtggctggaagggaaccccttgtgc
agaaccttccctagccatgctgcctacgtaagtgccatccgagattgtttccccaagttg
ttacgcctggatggcatagtgttacccttgccagttggcgttgacactaatgaactgcag
ttagtagaacccttcccggaacccccaaaagaaactgaaatgctgaagagtttgatcttg
cgcttcctgcaggagtattacttcatctatgactatggagatcgccggagtctccttcgt
acttaccacgagaaggcctgcttctccctgaccattccttttgatcccatggacccagtc
ccgagtggcttatgtgagtatttcaaggacagcaggaatatgatgtatctccaggacccc
tacctgcgaaggcagatgctgaagcacacaaactgggacattgtgaacaccctcaatgtg
ttgcccagaactcagcatgacttcatctccttctcaatggacatgtggttccagatggga
actgcgctctgcttttctgtcaacggggtgttcaagggaggaagtaattcttgggattct
gcatttatcttcacccggatcttcatcactgctcctagaagcagttctagtctgtgcatc
ctgaatgaccagctgtttgtgagagatgtcatgcctgttatccataacagctctgttcta
ggagccatacctggctctaacacaatggccgacctgaaccagctgcaacagaaaatggtg
caggctttctacatgcagtctgggatgaagctcgagtggtctcagaagtgccttgaggac
aacggatggaactacatcagagccaagaatatcttcattaccctcctgacccagagcaag
atcccacaggaggctttcaggcacatgccctag

KEGG   Oryctolagus cuniculus (rabbit): 100347351
Entry
100347351         CDS       T03373                                 
Symbol
NXF1
Name
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  Nucleocytoplasmic transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100347351 (NXF1)
   03015 mRNA surveillance pathway
    100347351 (NXF1)
   03008 Ribosome biogenesis in eukaryotes
    100347351 (NXF1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100347351 (NXF1)
   05168 Herpes simplex virus 1 infection
    100347351 (NXF1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100347351 (NXF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100347351 (NXF1)
   03009 Ribosome biogenesis [BR:ocu03009]
    100347351 (NXF1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100347351 (NXF1)
   mRNA cycle factors
    Stress granule specific factors
     100347351 (NXF1)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100347351 (NXF1)
SSDB
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_4 LRR_8 LRR_9
Other DBs
NCBI-GeneID: 100347351
NCBI-ProteinID: XP_002721042
Ensembl: ENSOCUG00000009503
LinkDB
Position
Un
AA seq 618 aa
MADEGKSYNEYDDRVSFPQRRKKGRGPFRWKYGESNRRSGRGGSGIRSSRLEEDDGDVAM
SDAQDGPRVRYTPYAARPNRRGDTWHGRERIHVTVRRDRAPLERGGAGTSQDGTSKNWFK
ITIPHGRKYDKSWLLNMIQSKCSVPFTPIEFHYENTRAQFFVEDASTASALKAINYKILD
RENKRISIFINSSTPPLTVQSELKPEQVEQLKVIMSKRYDGSQQALDLKGLRSDPDLLAQ
NIDVVLNRRSCMAAALRIIEENIPELLSLNLSDNRLFRLDDMSTLVQKAPNLKILNLSGN
ELKSERELDKIKGLKLEELWLDGNPLCDTFRDQSTYISAIRERFPKLLRLDGHELPPPIA
FDVEAPTLLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSIP
FIPQNPGRSSLAEYFKDSRNVKKLKDPTLRFRLLKHTRLNVVAFLNELPKTQHDVNSFVV
DISAQTNTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASA
EEIQRAFAMPAPTPSSSPVPTLSPEQQEMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQ
AFTHLKAKGEIPEVAFMK
NT seq 1857 nt   +upstreamnt  +downstreamnt
atggcggatgaggggaagtcgtacaacgagtacgatgaccgtgttagtttccctcaaaga
agaaagaaaggccggggtcctttccggtggaagtatggtgagagtaaccgtcgctctgga
agaggtggttctggtatccggtcttcccggcttgaggaggatgatggagatgtagcaatg
agtgacgcccaggatggtccccgagtacgatacaccccctatgctgcccgacccaaccgc
cggggcgacacttggcatggtcgagagcgtattcatgttactgtgcggagagacagagct
cctttagagcgaggaggggccggcaccagccaggatgggacctccaaaaactggttcaag
attacgattcctcatggcagaaagtatgacaagtcatggctcctgaacatgattcagagc
aagtgcagtgtcccattcactcccattgagtttcactatgagaacacacgggctcagttt
tttgtcgaggatgccagtactgcctctgcgttgaaggcgatcaactataaaattctggat
agggagaacaagaggatatccatcttcatcaactcctctaccccacccctcactgtgcag
agtgaactgaagccagaacaagtagagcagctgaaggtgatcatgagcaaacgctatgac
ggctcccagcaagcactggatctcaagggcctgcgttcagacccagatttgttggcccag
aatatcgatgttgtactgaatcgtagaagctgtatggcagctgccttgcgaatcattgaa
gagaatattccagagctcttgtccttgaatttgagtgacaataggctgttcagactggat
gacatgtccaccttggtacagaaggcacccaacctaaagatcctaaacctctccgggaat
gaattgaagtctgagcgagaattagacaagataaaagggctgaagctagaagagctgtgg
cttgatggaaatcccttgtgtgacaccttccgagaccagtccacctacatcagcgccatt
cgtgaacgattccccaagttgttacgcctggatggccatgagttacccccaccaattgcc
tttgatgttgaagccccaacactgttgccaccctgcaagggaagctattttggaacagaa
aacctgaagagtctggtcctgcacttcttgcagcagtattatgcaatttatgactctgga
gaccgacaggggctcctggatgcctatcatgatggggcctgctgttccctgagcattcct
ttcatcccccagaaccccggccgaagcagcttggcagagtacttcaaggatagcagaaat
gtgaagaagcttaaagaccctacactgcggttccgattgctgaagcacacacgtctcaac
gtggttgccttcctcaatgagttgcccaaaactcagcatgacgtcaattcctttgtagta
gacataagcgcccagaccaatacattgctgtgtttttctgtcaacggtgtctttaaggaa
gtggatggaaagtcccgggattctttgcgagcctttactcggacattcattgccgttcct
gccagcaattcagggctgtgtattgtaaatgacgagctatttgtgcggaacgcgagcgct
gaagagatccagagagccttcgccatgccggcccccacaccttcctccagccccgtgccc
accctctccccggagcagcaggaaatgttgcaggcgttctctactcagtctggcatgaac
cttgagtggtctcagaagtgccttcaggacaacaactgggactacaccagatctgcccag
gccttcactcatctcaaggccaaaggtgagatcccagaagtggcattcatgaagtga

KEGG   Oryctolagus cuniculus (rabbit): 103351963
Entry
103351963         CDS       T03373                                 
Name
(RefSeq) nuclear RNA export factor 2
  KO
K14284  nuclear RNA export factor
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  Nucleocytoplasmic transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
ocu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    103351963
   03015 mRNA surveillance pathway
    103351963
   03008 Ribosome biogenesis in eukaryotes
    103351963
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    103351963
   05168 Herpes simplex virus 1 infection
    103351963
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    103351963
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    103351963
   03009 Ribosome biogenesis [BR:ocu03009]
    103351963
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     103351963
   mRNA cycle factors
    Stress granule specific factors
     103351963
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103351963
SSDB
Motif
Pfam: TAP_C NTF2 Tap-RNA_bind LRR_4 UBA_4 LRR_8 DUF3601
Other DBs
NCBI-GeneID: 103351963
NCBI-ProteinID: XP_008271322
Ensembl: ENSOCUG00000009877
UniProt: G1SY35
LinkDB
Position
X:complement(87349468..87377578)
AA seq 565 aa
MYSVQEKYGMYQIGECGAVSTLNQGMKKDWDSSHGYLCQENLHYEHNEYKPSPSYHQENN
RIIAIVNTQQDLQLECTPYSMECKKRKKKCNRDKVHGELCRYKKRPNRDMGEEKQDGTLP
CWIKVTFHYINNEAQFFVQDAITESALKECRLLPEEMEQLKLTLNKRYDAYTESLDLQRL
YYDPDLVGHDIDMILNQRHCMAAILHIIEKQFPELFCLNLRNNKLYQLDDLSDIIGKAPK
IKILNLSDNELKMALELQKLKELKLEELWLKGNPLCSTFSDHAAYVSLILDCFPNLLRLD
GRELYPRAVTEIVLMKPCKDSYQGPELLKNLILHFLQQYYFIYDYGDRRTLISVYHEKAC
FSLSTAFHSMDPDPSAFYGYVKNNRNMKDIKDSYLRRKLLKHRNHTIVDALSMLPRTQHD
FNSFSIDMWFHTDTMISFAVNGLFRGESNSQNLMFAFTRTFIVIPSMNSMLCILNDQLFV
RNVNPVNVHTVFTIPGSIPCSSCTPTVSQLQHELEQAFSSLSGMKFEWCRKCLEENGWNY
TRAAQVFLILQMQGKIPKEAFKQIT
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgtattctgttcaagagaagtatgggatgtaccaaattggagaatgtggtgctgttagt
acccttaatcaaggaatgaagaaagattgggattcatcccacggttatttatgccaggag
aatcttcattatgaacataatgagtacaagccttcaccttcataccaccaggagaataat
agaatcatagcaatagtgaatacccaacaggacctacaattagagtgcactccatatagt
atggaatgcaagaagaggaaaaagaaatgtaatcgtgacaaagtccatggagaattgtgc
agatataaaaaacgccccaatagagacatgggggaggagaaacaggatggaactctacca
tgctggatcaaggtcacatttcattacatcaacaacgaggcccagttttttgttcaagat
gctattactgaatctgcactgaaggagtgtcgtttgctgccagaggaaatggagcagcta
aagttgaccttgaacaaacgatatgatgcctacacagaatcccttgatctacagagatta
tattatgatccagacttggtgggccatgatattgacatgatactgaaccaaagacactgc
atggctgccatcctgcatatcattgaaaagcaatttcctgagctgttttgtttgaattta
cgcaacaacaaactgtatcagctggatgacctatctgacatcatagggaaggccccaaaa
atcaagatcttgaacctttctgacaatgagcttaagatggcattggagttacagaagttg
aaagagctaaagcttgaagaattgtggctgaaaggaaaccctttgtgtagcacattcagt
gaccatgctgcctatgtaagtttgattctggattgtttccccaatttgttgcgcctggat
ggcagagagttataccctcgcgctgtcactgaaattgtgttaatgaagccctgcaaggac
agctatcaaggacctgaattactgaaaaatctgatcctgcatttcctgcaacaatattac
tttatttatgactatggagatcgccgtactctcattagtgtttaccatgagaaggcctgc
ttctctctgagcactgccttccactccatggatccagacccgagcgccttctatggctat
gtcaagaacaacaggaatatgaaggatatcaaggattcctacctgagaaggaaattgctt
aagcacagaaaccataccattgtggatgccctcagtatgttgccaagaactcaacatgac
tttaactccttctcaatagacatgtggttccacacggatacgatgatcagttttgctgtt
aatggattattcagaggagaaagtaattctcagaatttgatgtttgccttcacccggact
ttcatcgttatcccaagcatgaattccatgctttgtatcctgaatgatcaactgtttgtg
aggaacgtcaatcctgtcaatgtccatacagtcttcaccatcccaggaagcattccatgc
tccagttgtacacccaccgtttcccagctgcagcatgaattggagcaagctttctcctct
ctgtctgggatgaaatttgagtggtgcaggaagtgccttgaagagaatggatggaactac
accagagcggcacaggtcttccttatcctccagatgcagggcaagatcccaaaggaggcc
ttcaaacaaatcacataa

DBGET integrated database retrieval system