KEGG   Oryctolagus cuniculus (rabbit): 100338794
Entry
100338794         CDS       T03373                                 
Symbol
RAB11FIP3
Name
(RefSeq) RAB11 family interacting protein 3
  KO
K12485  Rab11 family-interacting protein 3/4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100338794 (RAB11FIP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338794 (RAB11FIP3)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    100338794 (RAB11FIP3)
SSDB
Motif
Pfam: RBD-FIP EF-hand_7 EF-hand_6 EF-hand_1 ZapB WD40_alt EF-hand_5 Tubulin_3
Other DBs
NCBI-GeneID: 100338794
NCBI-ProteinID: XP_008250927
Ensembl: ENSOCUG00000029653
LinkDB
Position
Un
AA seq 738 aa
MEPGRPASPPGPDSEPGASAGPAPGPSECDEPAPGLEDPQDTGPPSRGARGQDADAGARQ
AACPEPDPRSEVASPEPDPRSEVASPEPDPRSEVASPEPDPRSEVASPDPDPPFSWTKGP
EDCGLPPCPESPSFCVQAPALSFGVRDAADLFPAFPSPAVDELAPEEGRASPEQPLPGEP
AGCPEDGPRLRAVFDALDGDGDGFVRIEDFVQFATAYGAEQVKDLTQYLDPSGLGVMSFA
DFYHGITAIRNGDRDGQLCGVPPAQDGEPSACPVEFDDFVTYEANEVTDSAYMGSESTYS
ECETFTDEDTGTLVHPELQPAGDTDSAGGSAAPSECLDTMEEPGHGALLLLPGRSHPRGQ
SVVMVIGGEEHFEDYGEGTEVEVSPEALSDGELTCSDPAFLTPSPTKRLSSRKVARYLHQ
SGALTMDALEDPPLEPVEGPEEDIADKVVFLERRVSELEKDTAATGEQHSRLRQENLQLV
HRANALEEQLKEQELRACETVLGEARRQKELLCRLEREKSIEIENLQARLQQLDEENSEL
RSCTPCLKASIERLEEEKRKLLDEMEELTLRLREEQEKKRKMGDKLSHERHQFQRDKEAT
QELIEDLRRQLEHLQLFKLEAEQRRGRSSSAGLQEYNTRARESELEQEVRRLKQDNRSLK
EQNDELNGQIITLSIQGAKSLFATSFSESLAAEISSVSRDELMEAIQKQEEINFRLQDYI
DRIIVAIMETNPSILEVK
NT seq 2217 nt   +upstreamnt  +downstreamnt
atggagccgggccggccggcctcccctccgggccccgactcggagccgggcgcgtccgcc
gggccggccccgggtccctcggagtgcgatgagccggccccggggctggaggaccctcag
gacaccgggccgcccagccgcggtgcgcgggggcaggatgcggacgccggggcccgccag
gccgcctgcccggagcccgacccgcgttccgaggtggcatccccggagcccgacccgcgt
tccgaggtggcatccccggagcccgacccgcgttccgaggtggcatccccggagcccgac
ccgcgttccgaggtggcatccccggaccccgacccgcctttctcctggaccaaaggcccg
gaggactgtggtctcccgccgtgcccggagagcccgtctttctgcgtgcaggctccggct
ctcagcttcggtgtgcgggatgcggccgacctgttccccgccttcccttcgcctgccgtg
gacgagctggcgccggaggagggtcgggcatccccggagcagccccttcctggcgagccc
gcggggtgtccggaggacggcccccgcctgcgagcggtgttcgacgccctggacggggat
ggggacggcttcgttcgcatcgaggacttcgtccagttcgctacggcctacggggccgag
caggtgaaggacttaactcagtacctggatcccagtgggcttggtgtgatgagtttcgca
gacttctaccacgggatcacagccatcaggaacggagatcgcgatggacagctgtgcgga
gtcccccctgcccaggacggagagccctctgcctgccccgtcgagttcgatgacttcgtc
acctatgaggccaacgaggtgacagacagtgcctacatgggctctgagagcacctacagt
gagtgcgagaccttcaccgatgaggacactggcaccctggtacaccccgagctgcagcct
gcaggggacacagacagcgccggcggctcggccgcaccctccgagtgcctggacaccatg
gaggagcccggccatggtgctctgctgctgctcccgggcaggtctcacccgcgcggccag
tctgttgtcatggtgatcggcggcgaggagcattttgaggactacggggaaggcaccgag
gtggaggtgtctccggaggccctctctgacggggagctcacctgcagtgatcctgctttt
ctcacccccagtccgacgaagcggctctccagcaggaaggtggcaaggtacctgcaccag
tcaggggccctgaccatggatgccctggaggaccctcccctggagcctgtggagggccca
gaggaggacattgccgacaaggtggtcttcctggagagacgcgtgtcagagctggagaag
gacaccgcagccaccggggagcagcacagccggcttcggcaggagaacctccagctggtg
cacagagccaacgccctggaggagcagctgaaggagcaggagctgcgagcctgcgagacg
gtcctgggggaggcccggcggcagaaggagctgctgtgcaggctggagcgagagaagagc
atcgagatcgagaacctgcaggccaggctgcagcagctggatgaggagaacagtgagctc
cggtcctgcacgccctgtctgaaggccagcatcgagcgcctggaggaggagaagcgcaag
ttgctggatgagatggaagagttgactctgcggctcagggaggagcaggagaagaagagg
aagatgggggacaagctgagccacgagaggcaccagttccagagggacaaggaggcgacc
caggagctgatcgaggacctgcgcaggcagctggagcacctgcagctcttcaagctggag
gccgagcagcggcggggccgcagcagcagcgcaggcctgcaggagtacaacacccgcgcc
cgcgagagcgagctggagcaagaggtccgcaggctgaagcaggacaaccgcagtctgaag
gagcagaacgacgagctgaacgggcagatcatcacgctgagcatccagggcgccaagagc
ctcttcgccacgtccttctccgagtccttggccgcagagatcagctccgtctcccgcgac
gagctcatggaagcgattcagaagcaggaggagatcaacttccgcctgcaggactacatc
gacaggatcatcgtggccatcatggagaccaacccgtccatcctggaggtcaagtag

KEGG   Oryctolagus cuniculus (rabbit): 100351848
Entry
100351848         CDS       T03373                                 
Symbol
RAB11FIP4
Name
(RefSeq) RAB11 family interacting protein 4
  KO
K12485  Rab11 family-interacting protein 3/4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100351848 (RAB11FIP4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351848 (RAB11FIP4)
Membrane trafficking [BR:ocu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Rab11 associated proteins
    100351848 (RAB11FIP4)
SSDB
Motif
Pfam: RBD-FIP bZIP_1 EF-hand_8 bZIP_2 EF-hand_7 Leu_zip EF-hand_9 Shugoshin_N VGPC1_C
Other DBs
NCBI-GeneID: 100351848
NCBI-ProteinID: XP_008269276
Ensembl: ENSOCUG00000007443
LinkDB
Position
19:21051546..21159898
AA seq 639 aa
MAGGAGWAGAPAALLRSVRRLRQVFEVCGRDPDGFLRVERVAALGLRFGQGEEVEKLVKY
LDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCAPEIPDCVEQGSEVPGPT
FADGELIPTEPGFFPEDEEEAMTLAPPEGPPESDMDSPMESTQGLEGPVGSAGMEERGPG
LGGLFLPDHKSLMHAPSVTTSDLSTHSTASLISNEEQFEDYGEGDDVDCAPSSPCPDDET
RTNVYSDLGSSVSSSAGQTPRKMRHAYNSELLDVYCSQCCKKINLLNDLEARLKNLKANS
PNRKISSTAFGRQLMHHSNFSSSNGSTEDLFRDSIDSCDNDITEKVSFLEKKVTELENDS
LTNGDLKSKLKQENTQLVHRVHELEEMVKDQETTAAQALEEEARRHREACSKLEREKSTE
LELLHSRVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLEDTSLRLKDEMDLYKRM
MDKLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGRGRSSSSSLGEFNARAR
EVELEHEVKRLKQENHKLRDQNDDLNGQILSLSLYEAKNLFATQTKAQSLAAEIDTASRD
ELMEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
NT seq 1920 nt   +upstreamnt  +downstreamnt
atggcgggcggcgcgggctgggcgggcgcccccgcggctctgctgcgctccgtgcgccgc
ctgcgccaggtgttcgaggtgtgcggccgcgaccccgacggcttcctgcgcgtggagcgc
gtcgcggcgctcggcctgcgcttcggccagggagaagaggtagagaagctcgtcaagtat
ttggatcccaacgacctggggaggatcaacttcaaggacttttgccgtggggtgttcgcc
atgaaagggtgcgaggagctgctgaaggatgtgctgtccgtggagagcgcagggacgctg
ccgtgcgcgcccgagatccctgactgtgtggagcagggcagcgaggtcccaggccccacc
tttgctgatggcgagctcatccccacggagcccggcttctttcccgaggacgaggaggag
gcgatgacgctggcccctcccgagggccctcccgagtcggacatggacagccccatggag
agcacccagggcctggagggccccgtcgggagtgccggcatggaggagcggggcccgggg
ctcgggggcctgtttctgccagaccacaagtctctgatgcacgccccatcggtgacgaca
tccgacctgtccacgcactccactgcctcgctcatcagcaacgaggagcagtttgaagac
tatggagagggtgacgacgtggactgtgcccccagcagcccctgccccgacgacgagacc
aggaccaatgtctactcagacctggggtcctccgtgtcttccagtgcggggcagaccccc
aggaagatgcggcacgcctacaacagcgagctgctggacgtgtactgctctcagtgctgc
aagaaaatcaacctgctcaacgacctggaggcccggctgaaaaacctcaaggccaacagc
cccaaccgcaagatctcgagcacggccttcggacggcagctcatgcaccacagcaacttc
agcagcagcaacggcagcaccgaggacctgttccgggacagcatcgactcctgtgacaat
gacatcacagagaaggtgagcttcctggagaaaaaggtgacggagctggagaacgacagc
ctgaccaacggggacctgaagagcaagctgaagcaggagaacacgcagctggtgcacagg
gtgcacgagctggaggagatggtgaaagatcaggagaccacggccgcacaggcgctggag
gaggaggcccggcgacaccgcgaggcctgcagcaagctggagagggagaagagcacggag
ctggagctgctgcatagcagggtgcagcagctggaggaggaaaacactgagctccggacg
acggtgacgcggctcaagtcgcagacggagaagctagatgaggagcggcaacgcatgtcc
gaccggctggaggacaccagcctgcggctcaaggatgagatggacctgtacaaacgcatg
atggacaagctgcgccagaaccgcctcgagttccagaaggagcgggaggccacccaggag
ctcatcgaggacttgcggaaggagctggagcacctgcagatgtacaagctggactgcgag
cggcctggccggggacgcagctcgtcgtccagcctgggcgagttcaacgccagggcccgc
gaagtggagctggagcacgaggtcaagcggctgaagcaggagaatcacaagcttcgggat
cagaacgacgacctgaacggccagatcctgagcctcagcctctacgaagcaaagaacctg
tttgccacgcagaccaaagcccagtccctggctgccgaaatcgacacggcctcacgcgac
gagctcatggaagccctgaaggagcaggaggagatcaacttccggctgcggcagtacatg
gacaagatcatcctcgccatcctggaccacaacccctccatcctggagatcaaacactga

DBGET integrated database retrieval system