KEGG   Oryctolagus cuniculus (rabbit): 100338816
Entry
100338816         CDS       T03373                                 
Symbol
SEMA3F
Name
(RefSeq) semaphorin 3F
  KO
K06840  semaphorin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100338816 (SEMA3F)
SSDB
Motif
Pfam: Sema I-set Ig_3 Ig_2 PSI Ig_6 ig
Other DBs
NCBI-GeneID: 100338816
NCBI-ProteinID: XP_017199318
Ensembl: ENSOCUG00000011670
LinkDB
Position
9:17636008..17657796
AA seq 785 aa
MPVAGLLLWAFLLAGAWPAAPTQDYLPATPRVRLSFRELKATGTAHFFNFLLNTTDYRIL
LKDEDHDRMYVGSKDYVLSLDLHDINREPLIIHWAASPQRIEECVLSGKDGNGECGNFVR
LIQPWNRTHLYVCGTGAYNPMCTYVNRGRRAQATPWTQTQVARGRGSRATDGTLRPTPTP
PRQDYIFYLEPERLESGKGKCPYDPKLDTASALINEELYAGVYIDFMGTDAAIFRTLGKQ
TAMRTDQYNSRWLNDPAFIHAELIPDSAERNDDXLYFFFRERXGRGAADPAVYARIGRIC
LNDDGGHCCLVNKWSTFLKARLVCSVPGEDGIETHFDELQDVFVQQTQDVRNPVIYAVFT
SSGSVFRGSAVCVYSMADIRMVFNGPFAHKEGPNYQWMPFSGKMPYPRPGTCPGGTFTPS
MKSTKDYPDEVINFMRSHPLMYQAVYPLQRRPLVVRTGAPYRLTTVAVDQVDAADGRYEV
LFLGTDRGTVQKVIVLPKDDQEVEELMLEEVEVFKDPAPVKTMTISSKRQQLYVASAVGV
THLSLHRCQAYGAACADCCLARDPYCAWDGQACSRYTASSKRRSRRQDVRHGNPIRQCRG
FNSNANKNAVELVQYGVVGSATFLECQPRSPQATVKWLFQRDPGDRRREIRAEDRFLRTE
QGLLLRALQLGDRGLYSCTATENNFKHVVARVQLHVLGREAVHAALFPSLAVSAPPPPGA
GPPTPPYQELAQLLAQPEVGLIHQYCQGYWRHVPPSPREAPGAPRPPEPQDQNKPRSRRH
HPPDT
NT seq 2358 nt   +upstreamnt  +downstreamnt
atgcctgtcgctggcctcctcctctgggctttcctactcgccggggcctggccagccgcc
cccacccaggactacctcccggccacgccccgagtccggctctccttcagagagctgaag
gccacaggcactgcccacttctttaacttcctgctcaacaccactgactaccggatcctg
ctcaaggacgaggaccacgaccgcatgtacgtgggcagcaaggactacgtgctgtccctg
gacctgcatgacatcaaccgtgagcccctcattatccactgggcggcctccccacagcgc
attgaggagtgcgtgctgtcaggcaaggatggcaacggggagtgcgggaacttcgtcagg
ctcatccagccctggaaccgaactcatctgtatgtgtgtgggacgggcgcctacaacccc
atgtgcacctatgtgaatcggggccgtcgtgcccaggccacgccgtggacccagacgcag
gtggccagaggccgcggcagcagagccacggatggcaccctccgcccgacgcccacaccc
ccacgccaggattacatcttctacctggagcctgagcgcctcgaatcagggaagggcaag
tgtccgtacgaccccaagctggacacggcctcagcgctcatcaacgaggagctctacgcc
ggcgtgtacatcgattttatgggcacggacgcggccatcttccgcacgctgggaaagcag
acggccatgcgtacggatcagtacaactcccggtggctcaatgaccccgccttcatccac
gcggagctcatccccgacagcgccgagcgcaacgacgacnagctgtacttcttcttccgc
gagcgtnncggcagaggcgccgcagaccccgccgtgtacgcccgcatcgggcgcatctgc
ctgaatgacgacggcggccactgctgcctggtgaacaagtggagcacgttcctgaaggcg
cggctcgtctgctccgtgccgggcgaggatggcatcgagacgcacttcgacgaactgcag
gacgtgtttgtccagcagactcaggacgtgaggaacccagtcatctacgccgtcttcacc
tcctcaggctccgtgttccgcggctccgctgtctgtgtctactccatggctgacatccgc
atggtcttcaacgggccctttgcccacaaggagggccccaactaccagtggatgcccttc
tcggggaagatgccttacccccggcctggcacgtgtcctggcggaaccttcaccccgtcc
atgaagtccaccaaggactaccctgacgaagtcatcaacttcatgcgcagccaccccctc
atgtaccaggccgtgtaccctctgcagcgccggcccctggtggtccgcacgggggcaccc
taccgactcaccactgtcgcggtggaccaggtggatgcggccgacgggcgctatgaggtg
cttttcctgggcacagaccgcgggacagtgcagaaggtcatcgtgctgcccaaggacgac
caggaggtggaagagctcatgctggaggaggtggaggtcttcaaggacccagcacctgtt
aagaccatgaccatctcttccaagaggcaacaactctacgtggcctcagccgtgggcgtc
acacacctgagcttgcaccgctgccaggcctatggggctgcctgtgccgactgctgcctc
gcccgggacccctactgcgcctgggatggccaggcctgctcccgctacacagcatcctcc
aagaggcggagccgccggcaggacgtgcggcatgggaatcccatcaggcagtgccggggg
ttcaactccaatgccaacaagaatgccgtggagttggtgcaatatggtgtggtgggcagt
gccaccttcctggagtgccagccccgctcgccccaagccacggttaagtggctcttccag
cgagatcccggcgaccggcgccgagagatccgcgcagaggaccgcttcctgcgcacggag
cagggcttgctgcttcgcgccctgcagctcggtgaccgcggcctctactcctgcacagcc
actgagaacaacttcaagcacgtcgtcgcgcgggtgcagctgcacgtgctgggccgggaa
gccgtccatgccgccctcttcccgtcactggctgtgagcgccccgccgcctcccggcgca
ggcccccccacgcctccttaccaggagctggcccagctactggcccagccagaagtgggc
ctcatccaccagtactgccagggttactggcgtcacgtgcctcccagccccagggaggcc
ccaggggcacccaggcctccggagccccaggaccagaacaagcctcggagccgccggcac
catcctccggacacctga

KEGG   Oryctolagus cuniculus (rabbit): 100339559
Entry
100339559         CDS       T03373                                 
Symbol
SEMA3B
Name
(RefSeq) semaphorin 3B
  KO
K06840  semaphorin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100339559 (SEMA3B)
SSDB
Motif
Pfam: Sema V-set ig PSI Ig_3
Other DBs
NCBI-GeneID: 100339559
NCBI-ProteinID: XP_002713257
Ensembl: ENSOCUG00000002344
LinkDB
Position
9:17722593..17733640
AA seq 752 aa
MGRAEAAAMILGLALLWAEGLGGTTPSPPRLRLSFQELQTRHGLRTFRLERTCCYEALLV
DEERGRLFVGAENHVASLSLDNISKRAKKVAWPAPVEWREECNWAGKDIGTECMNFVKLL
HAYNRTHLLACGTGAFHPTCAFVDVGHRPEEPTLRLDLRRLEDGKGKSPYDPRHRAASVL
VGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDD
KIYFFFRELAVEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVCSVPGVEG
DTHFDQLQDVFLLSSRERRTPLLYAAFSTSSGVFQGSAVCVYSMDDVRRAFLGPFAHKEG
PTHQWVSYQGRVPYPRPGMCPSKTFGTFGSTKDFPDDVIQFARNHPLMYNSVLPVGGRPL
FLRVGAGYTFTQIAADRVAAADGHYDVLFIGTDVGTVLKVISMPKGSRPNAEGLLLEELH
VFQDAAAVTSMQISSKRHQLYVASRSAVAQIALHRCAAHGRACAECCLARDPYCAWDGAT
CTRFQPSAKRRFRRQDVRNGDPSTLCSGDSSRPVLLERKVFGVEGGSALLECEPRSLQAR
MEWTFQRAGEAAHTQVQAEERADLTAQGLLLRGLRRGDSGVYLCAAVEQGFSQPLRRVAL
HVLSVAQAERLARAEEVAPAAALPGPKLWYRDFLQLVEPGGGGGANSLRMCQPQPQPAAH
APAQTARRKGRNRRTHTSEARAERGPRSAAHW
NT seq 2259 nt   +upstreamnt  +downstreamnt
atggggcgggctgaggccgccgccatgatcctgggcctggccctgctctgggcagagggg
ctggggggtaccacccccagccccccacgccttcggctctccttccaagagctccagacc
cggcacgggctgcggaccttccggctggagcggacctgctgctacgaggccttgctggtg
gatgaagagcgtggtcgcctgttcgtgggtgccgagaaccatgtggcctccctgagcctg
gacaatatcagcaagcgggccaagaaggtggcctggccagcccccgtggagtggcgagag
gagtgcaactgggccggaaaggacattggcacggagtgcatgaactttgtgaagctgctg
catgcctacaaccgcacccacctgctggcctgtggcacaggggccttccacccaacctgt
gcgtttgtggatgtgggccaccggcccgaggagcccacgctccggctggacctgcgaaga
cttgaggacggcaaggggaagagtccttacgacccgaggcatcgggctgcctccgtgctg
gtgggggaggagctgtactcgggggtggcagcagacctcatgggccgggacttcaccatc
ttccgaagcctgggccagcgtccgagtctccgaacagagccacatgactctcgctggctc
aacgagcccaaatttgtgaaggtcttttggatcccggagagcgagaacccagatgacgac
aaaatctacttcttcttccgtgagttggcggtggaggctgcgccggccctaggacgcctg
tcggtgtcccgtgttggccagatctgccggaacgacgtgggcggccagcgcagcctcgtc
aacaagtggacaacgttcctgaaggcacgactggtgtgctcggtgcctggtgtcgagggt
gacacccacttcgaccagctccaggacgtgttcctgctgtcttcgcgggagcgccgcacc
ccactgctctacgccgccttttctacgtccagcggcgtcttccagggctcagccgtgtgt
gtgtacagcatggatgatgtgcgccgtgccttcctgggaccttttgcgcacaaagagggg
cccacacaccagtgggtgtcctaccagggccgcgttccctacccacggccgggcatgtgc
cccagcaagacctttggcaccttcggttccaccaaggacttccccgatgacgtcatccag
tttgcccggaaccatcctctcatgtacaactcggtgctgcccgtgggggggcgccctctt
tttctacgagtgggcgccggatacaccttcacccaaatcgcggccgaccgcgtggcagct
gcggatggccactatgacgtcctcttcattggcacagacgtaggcacagtgctgaaggtg
atctccatgcccaagggcagccgacctaacgcggaagggctgcttctggaggagctgcac
gtgttccaggacgcagctgctgtcaccagcatgcaaatctcctccaagaggcaccagctg
tatgtagcctcgcggagcgctgtggcgcagatcgcgctgcaccgctgcgccgcccacggc
cgcgcctgcgccgaatgctgtctggcgcgtgacccttactgtgcctgggacggggcgacg
tgcacgcgcttccagcccagcgccaagaggcggttcaggagacaagacgtaaggaacgga
gaccccagcacgctgtgctccggggactcgtcccgccccgtgctgttggagcggaaggtg
ttcggggtggaaggtggcagcgcgcttctggaatgtgagccccgttcgctgcaggcacgc
atggaatggaccttccagcgcgcaggcgaggcggcccacacccaggtgcaggcggaggag
cgcgccgacctcaccgcgcagggcctgctgctgcgcgggctgcggcgcggggactctggc
gtgtacctgtgcgccgccgtcgagcagggcttttcgcagccgctgcggcgagtggcgctg
cacgtgctgagcgttgcgcaggccgaacggctggcgcgggcagaggaggttgcgccggct
gcagctctgccgggccccaaactctggtaccgggacttcctgcagctggtggagccgggc
ggcggaggcggcgcgaactccttgcgcatgtgccagccccaaccgcaacccgcggcccac
gccccggcccagactgcacggaggaagggccgcaacaggcggacgcacacctctgaggcg
cgagcagagcgcgggccgcgcagcgcggcgcactggtga

KEGG   Oryctolagus cuniculus (rabbit): 100340404
Entry
100340404         CDS       T03373                                 
Symbol
SEMA3E
Name
(RefSeq) semaphorin 3E
  KO
K06840  semaphorin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100340404 (SEMA3E)
SSDB
Motif
Pfam: Sema V-set ig PSI
Other DBs
NCBI-GeneID: 100340404
NCBI-ProteinID: XP_017199855
Ensembl: ENSOCUG00000010520
LinkDB
Position
10:44317219..44565598
AA seq 808 aa
MDRAARILAWVLGGHLLGLWAGGHAADAPHPRLRLSHKELLELNRTSLFHSPFGFLDLQA
MLLDDYQERLFVGGRDLLYSLSLDRLSDGYREIHWPSAAPKIEECIMKGKDASECANYIR
VLHHYNRTHLLACGTGAFDPLCAFVRVGYHSKDPRFHLESHRSERGRGRCPFDPGSSFTS
TLIGSELFAGLYSDYWGRDAALFRSPGQLAPIRTEPDNERLLKEPKFVGSYMIPDNEDRD
DNKVYFFFTEKALEAEHGAHAIYARVGRLCVNDAGGQRILVNKWSTFLKARLVCSVPGVN
GIDTYFDELEDVFLLQTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIREAFNGPYAHK
EGPEYHWSLYEGRVPYPRPGSCASKVNGGRYASTKDYPDDAVRFTRGHPLMYQPIKPAHK
KPILVKTDGKYNLKQIVVDRVEAEDGQYDVLFIGTDNGIILKVITIYNQETESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYVGAASAVAQVRFHHCGMYGSACADCCLARDPYCAWD
GIACSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFVGRSREAGGRRCAEPGESRSPGE
RGAGPSRLPELRACRRRRSPSPVSGFLPAACSGSDLHLAVVCSCDDPGEPAIASRITSDS
TVSRVLKVDLGLLFLRLHRSDAGTYFCQTVEHGFVHAIRSISLEVVAEERVQRMVGKDPG
ERGPARAPCPAHAGGPPGARPWYKEFLQLIGYSNFQRVEEYCEKVWCADKRRKRLKLAPS
KWKFASPQEKRPHSKSEHYRLPRHTPGS
NT seq 2427 nt   +upstreamnt  +downstreamnt
atggaccgggctgcgcgcatcctagcctgggtcctggggggccacctgctgggactgtgg
gccggcggccacgcggcggacgccccgcacccccgactgcgtctgtcacataaagagctc
ctggaactgaaccgaacgtcgctatttcacagcccgtttggatttctcgacctgcaggca
atgctgctggacgactaccaggagcgactcttcgtgggcggcagggacctcctgtattcc
ctcagcttggaccggctcagcgacggctacagggagatacactggccgagtgcagcacca
aaaatagaggaatgcatcatgaaaggaaaagacgcaagtgagtgtgcaaattacattcga
gttttgcatcactataacaggacccaccttctggcctgcgggacgggagctttcgacccc
ctgtgtgccttcgtcagagtcggataccactcgaaggacccccggtttcacctggaatcg
caccggtctgagcgaggaaggggcaggtgcccgttcgaccccggctcctccttcacctcc
actctgattggcagcgagttgtttgcgggcctctacagtgactactggggcagagacgcg
gccctcttccggagcccgggccagctggccccgatccgcaccgagcccgacaacgagcgc
ctgctgaaagaaccaaaatttgtagggtcctatatgattcccgacaatgaagatcgagac
gacaacaaagtgtatttcttttttactgagaaggccctggaggcggaacacggagcccac
gcgatttacgcccgcgtgggacgcctctgcgtgaacgacgcgggtgggcagaggatcctg
gtgaacaagtggagcaccttcctgaaggcgagactggtttgctcggtgccaggagtgaac
gggattgacacgtactttgatgaactcgaggatgtgtttttgctgcagaccagagatcat
aaaaacccagtgatatttggactctttaacactaccagtaatatatttagggggcatgcg
atctgtgtctatcacatgtccagcatccgggaagcctttaacgggccgtacgcccacaag
gaaggacctgagtaccactggtcactctacgaaggaagagtcccttacccaagacctggc
tcttgtgccagcaaggtgaacggagggcggtacgcgagcaccaaagactaccccgacgac
gccgtccgctttaccaggggccaccccctcatgtaccagcccataaaacctgcccacaag
aaacccatactggtcaaaacagacgggaaatataacctgaagcagatcgtggtggatcgg
gtagaagcggaggacggccagtacgacgtcttatttatcgggacagacaatggaattata
ctgaaagtcatcacaatttacaaccaggaaacagagtccatggaagaagtcattctagaa
gaacttcagatattcaaggatccagttcctattatttctatggagatttcctcaaagaga
caacagctgtacgtgggagctgcttcggccgtggctcaagtcagattccatcactgtggc
atgtacgggagcgcgtgtgccgactgctgcctggctcgggacccgtactgcgcctgggac
ggcatagcctgctcccggtactacccgacgggcacccacgcgaaaaggaggttccgcaga
caggacgtgcggcacggcaacgcggctcagcagtgctttggacagcagttcgtgggtagg
tcccgggaggccggcggtcgccggtgcgcagagcccggggagagcaggtctcccggcgag
cgaggggctgggccctctcgactccccgagttgagggcctgcagaagacggagaagtcct
tcccccgtcagcggctttcttcccgccgcgtgttctggttctgatttgcacctcgccgta
gtctgctcatgtgatgatcctggagagcctgcaattgcctcccgcattacgagtgacagc
accgtcagccgcgtgctcaaggtggacctgggcttgctcttcctgcggctgcacagatcc
gacgcgggcacctacttctgccagacggtggagcacggcttcgtgcacgcgatccggagc
atcagcctggaggtggtggccgaggagcgggtgcagcgcatggtcggcaaggaccccggg
gagcgcgggcctgccagggcgccctgccccgcgcacgccggcggcccgccgggagccagg
ccctggtacaaggagttcctgcagctgatcggctacagcaacttccagcgagtggaggag
tactgtgaaaaggtgtggtgcgcggacaagaggaggaagcggctgaagctggccccctcc
aagtggaagttcgccagcccccaggagaagaggccacactccaagtccgagcactaccgc
ctgccccggcacacgcccggctcctaa

KEGG   Oryctolagus cuniculus (rabbit): 100346280
Entry
100346280         CDS       T03373                                 
Symbol
SEMA3G
Name
(RefSeq) semaphorin 3G
  KO
K06840  semaphorin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100346280 (SEMA3G)
SSDB
Motif
Pfam: Sema ig Ig_6 Ig_3 PSI Ig_2 V-set I-set
Other DBs
NCBI-GeneID: 100346280
NCBI-ProteinID: XP_002713426
Ensembl: ENSOCUG00000007969
LinkDB
Position
9:complement(19508152..19518700)
AA seq 776 aa
MAPSAWAICCLLGGLQLSGGSPGPGVPRLRLSYRDLLSANRSAVFLGPRGSLGLRAMYLD
EYRDRLFLGGRDALYSLRLGQAWPDPREVLWPPRPGQREECVRKGRDPVTECANFIRVLQ
PHNRTHLLACGTGAFQPTCALITVGHRGEHVLHLEPSSLESGRGRCPHEPSRPFASTFVG
GELYTGLTADFLGREAMIFRSGGHRPALRSDSDQSLLHDPRFIMAARIPDNSDHADDKVY
FFFSETVPSPDGGPGRVTVSRVGRVCVNDAGGQRVLVNRWSSFLKARLLCSVPSPGGAET
HFDQLEDVFLLWPKVGKSPEVHALFSTVSAVFRGFAVCVYHMADIWEVFNGPFAHRDGPQ
YQWGPFGGKVPFPRPGVCPSKMTAQPGRPFGSTKDYPDEVLQFARTHPLMFRPVRPRRGR
PVLVKTHLAQQLRQIVVDRVEAEDGTYDVIFLGTDSGSVLKVMALQAGGSAEPEEVVLEE
LQVFKVPAPITEMEISVKRQMLYVGSQLGVAQLRLHQCETYGSACAECCLARDPYCAWDG
TSCTRYRPSPGKRRFRRQDIRHGNPALQCLGQSQEDEAWGLVATTTVYGTEHNSTFLECQ
PRSPQAAVRWFLQRPEDGGPDQVKTDERVVQTEQGLLFRRLSRLDAGTYTCTTLEHGFSQ
TIVRLALEVILATQLDSLFPREPRVEQSPARGSLASSPPKAWYKDILQLTGFANLPRVDE
YCERVWCGGLGERPGSFRSRGKQAKGKSWAGLELGKKVKSRVQAERNRTPREVEAM
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggccccctcggcatgggccatctgctgcctcctggggggcctccagctcagcgggggc
agcccgggccccggagtgccccgtctgcggctctcctaccgagacctcctgtctgccaac
cgctctgccgtgtttctgggtccccgtggctccctggggctccgggcaatgtacctggat
gagtaccgagatcgcctctttctggggggccgcgatgccctctactcgctgcggctgggc
caggcatggccagacccccgagaggtcctgtggccgccacggccaggccagagagaggaa
tgtgtccgcaaggggagagaccctgtgacggagtgtgccaacttcatccgggtactgcag
ccccacaaccggacccacctgctggcctgcggcacgggggccttccagcccacctgcgcc
ctcatcacggtcgggcaccgaggggagcatgtgctacacctggagcccagcagcctggag
agtgggcggggaaggtgcccacacgagcccagccgcccctttgccagcaccttcgttggc
ggggagctgtacacaggcctcacggctgacttcctggggcgcgaggccatgatcttccgc
agtgggggccatcggccggccctgcgttctgattccgaccagagcctcttgcacgatccc
cggttcattatggctgcccgcatccctgacaactccgaccatgctgatgacaaggtgtac
ttcttcttctccgagacggtcccctcacctgacggcggcccgggccgtgtcaccgtcagc
cgcgtgggccgcgtctgcgtgaacgacgcgggaggccagcgggtgctggtgaaccgatgg
agctccttcctcaaggccaggttgctctgctccgtgcccagcccagggggtgctgagacc
cactttgaccagctggaggatgtgttcttgctgtggcccaaggtggggaagagcccagag
gtgcacgcgctgttcagcactgtcagtgccgtgttccggggctttgctgtctgtgtgtac
cacatggcagacatctgggaagtcttcaatgggccctttgcccaccgagacggtcctcag
taccagtggggaccttttgggggcaaggtgcccttcccccgccctggcgtgtgccccagc
aagatgaccgcacagccaggacggccctttggcagcaccaaggactacccagacgaggtg
ctgcagtttgcccgcacccacccacttatgttccggcccgtgaggcctcggcgtggccgc
cctgtcctcgtcaagacccacctggcccagcagctgcgccagattgtggtggaccgcgtg
gaagctgaggatgggacctacgacgtcatcttcctgggaaccgactcaggctctgtgctc
aaagtcatggccctacaggctggaggctcagctgagcccgaagaggtggttctggaggag
ctgcaggtgttcaaggtgccagctcccatcacggagatggagatctctgtcaaacggcaa
atgctgtacgtaggttctcagctgggtgtggcccagctgcggctgcaccaatgtgagact
tacggcagcgcctgcgctgagtgctgcctggcccgggacccgtactgtgcctgggatggc
acctcctgtacccgctaccgccccagtcctggcaagcgccggttccgccggcaggacatc
cggcatggcaaccctgccctgcagtgcctgggccagagccaggaagacgaggcttgggga
cttgtggccaccaccacggtctacggcacagagcacaacagcaccttcctggagtgccag
cccaggtcaccccaggccgccgtgcgctggttcctgcagaggccagaggatggggggcct
gaccaggtaaagacggatgagcgagttgtgcaaacagagcaggggctactgttccgcagg
ctgagccgcctcgacgccggtacctacacctgcacaacgctggagcacggcttctcccag
accattgtccgtctggctctggaggtgatcctggccacgcagctggacagcttgtttccg
cgggagccaagggtagagcagtccccagcccggggcagcctggcctcttccccgcccaag
gcctggtacaaggacatcctacaactcactggctttgccaacctgccccgggtggatgag
tactgtgagcgcgtgtggtgtgggggccttggggagcgcccaggctccttccgcagccgg
ggcaagcaggccaagggcaagagctgggcagggctagagctgggcaagaaggtgaagagc
cgggtgcaggcggagcgcaatcggactccgagggaggtggaggccatgtag

KEGG   Oryctolagus cuniculus (rabbit): 100356972
Entry
100356972         CDS       T03373                                 
Symbol
SEMA3D
Name
(RefSeq) semaphorin 3D
  KO
K06840  semaphorin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100356972 (SEMA3D)
SSDB
Motif
Pfam: Sema Ig_6 Ig_3 V-set ig I-set PSI Ig_2
Other DBs
NCBI-GeneID: 100356972
NCBI-ProteinID: XP_002713888
Ensembl: ENSOCUG00000012016
UniProt: G1T2G1
LinkDB
Position
10:42911188..43193330
AA seq 777 aa
MNANKDERLKFGSQDFHLFHTLMMLTMTMLFLPVIGTSKQNIPRLKLTYKDLLLSNSCIP
FLGSSEGLDFQTLLLDEERGRLLLGAKDHIFLLSLVDLNRNFKKIYWPAAKERVELCKLA
GKDANTECANFIRVLQPYNKTHIYVCGTGAFHPICGYIDLGAYKEEVLFKLDAHGVESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLSG
AKFIGTFPIPDTYNPDDDKIYFFFRESSQESATSDKTILSRVGRVCKNDLGGQRSLINKW
TTFLKARLICSIPGSDGADTHFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHPVMYKSVYPAAGAPTFKRINVDYRLTQVVVDHVVAEDGQYDVMFLGTDIGTVLKVV
SISKEKWNMEEVVLEELQVFKHPSVILNMELSLKQQQLYVGSRDGFVQLSLHRCDTYGKA
CAECCLARDPYCAWDGSACSRYAPTSKRRARRQDVKYGDPITQCWDIEDSISHETADEKV
IFGIEFNSTFLECIPKSQQATIKWYIQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GLYYCKAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGKVKDLLAESRLRYKDYMQIL
SSPNFSLDQYCEQMWHREKRRQRNKGSPKWKHVQEMRKKRNRRHHRALDALPRTVAT
NT seq 2334 nt   +upstreamnt  +downstreamnt
atgaatgctaataaagatgagagactcaagttcggaagccaggattttcacctttttcac
actttgatgatgctaaccatgaccatgctgtttcttcctgtcattgggacttctaagcaa
aatattccacggctcaagctaacctacaaagacttgctgctttcaaacagctgtattccc
tttctgggttcatcagaaggattggatttccaaacacttctattggatgaggagaggggc
aggctgctcctgggagccaaggaccacatcttcctgctcagtttggttgacttaaacaga
aactttaaaaagatttattggcctgcggcaaaagaacgcgtggaattatgtaaattagct
gggaaggatgccaacacggaatgtgcaaatttcatacgagtgcttcagccctataacaaa
actcacatttatgtgtgtggaactggagcttttcatccaatatgtggatatattgatctt
ggagcctacaaggaggaagttctgttcaagctggacgcacacggcgtggagtccggcaga
ctgaagtgtccttttgatccacagcagccgtttgcttcggtcatgacagatgaatacctc
tactctggaacagcctctgatttccttggcaaggacacggcattcacacggtctcttggg
ccgactcacgaccaccattacatcagaaccgacatttcagagcactactggctaagtgga
gccaaatttattggaacattccccataccagacacctacaatccagatgatgataaaata
tatttcttctttcgtgaatcatctcaagaaagtgctacttctgataagaccatcctttct
cgcgttggaagagtttgtaagaatgacctaggaggacaacgcagcctgataaacaagtgg
acgactttccttaaggccagattgatttgctccattcctggaagtgatggtgcagacaca
catttcgatgagctgcaagatatttatttactccccacaagagatgaaagaaatcctgta
gtatatggagtcttcaccacaaccagttccatcttcaaaggctctgcagtgtgtgtgtac
agcatggctgacatcagagcagtgttcaatggtccatatgctcacaaggagagtgcagac
caccgctgggtgcagtatgatggaagaattccttatccccgacctggcacatgtccaagc
aaaacctatgaccctctgattaagtccacccgcgatttcccagatgatgtcatcagtttc
atcaaacggcaccccgtgatgtataagtcagtgtacccggccgcgggtgcccccaccttc
aagcggatcaacgtggattacagactgacacaggtggtggtggaccacgtggttgcagaa
gacggccagtacgacgtcatgttccttgggacagacattggaaccgtcctcaaagttgtc
agcatctccaaggagaagtggaacatggaggaggtggtgctggaggagctgcaggtcttc
aagcacccatcagtcatcttgaacatggagctgtctctgaagcagcaacagctgtacgtc
ggttcccgcgatgggtttgttcagctctccctgcacaggtgcgacacgtacgggaaagct
tgtgcggagtgctgtctagccagagacccctactgtgcctgggacggaagtgcctgctcc
cgatacgcacccacttctaaaaggcgagctagacgccaagatgtgaagtatggggaccca
atcacccagtgttgggatatagaagacagcattagtcatgaaactgctgatgaaaaggtg
atttttggcattgaatttaattcaacttttctggaatgtatacctaaatcccagcaagca
accattaagtggtatatccagcggtcaggagatgagcatcgagaggagttgaaacctgat
gaaaggatcatcaaaacggagtacgggctactgatccgcagtctgcagaagaaggactct
gggctgtattactgcaaagcgcaggagcacactttcatccacaccatagtgaaactgact
ttgaacgtcattgagaacgaacagatggagaatacccagagggcagagcacgaggagggg
aaggtcaaggatctgttggctgagtcacggttgagatacaaagactacatgcagatcctg
agcagcccaaacttcagcctggaccagtactgtgagcagatgtggcaccgggagaagcgg
aggcagcggaacaagggcagtcccaagtggaagcacgtgcaggagatgaggaagaaacgg
aaccggagacaccaccgagcgctggacgcgcttcctaggactgtggctacgtag

KEGG   Oryctolagus cuniculus (rabbit): 100357227
Entry
100357227         CDS       T03373                                 
Symbol
SEMA3A
Name
(RefSeq) semaphorin 3A
  KO
K06840  semaphorin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100357227 (SEMA3A)
SSDB
Motif
Pfam: Sema ig Ig_6 V-set PSI Ig_3 Ig_2 I-set
Other DBs
NCBI-GeneID: 100357227
NCBI-ProteinID: XP_002713889
Ensembl: ENSOCUG00000011919
UniProt: G1T285
LinkDB
Position
10:43846720..44059169
AA seq 770 aa
MGWCTGLVCLLWGALLTARANYQNGKNNVPRLKLSYKEMLESNNVITFNGLANSSSYHTF
LLDEERSRLYVGAKDHIFSFNLVNIKDFQKIAWPVSYTRRDECKWAGKDILRECANFIKV
LKVYNQTHLYACGTGAFHPICTYVGIGHHPEDNIFKLEDSHFENGRGKSPYDPKLLTASL
LIDGELYSGTAADFMGRDFAIFRTLGQHHPIRTEQHDSRWLNDPRFISAHLIPESDNPED
DKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNG
IDTHFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFRGSAVCMYSMSDVRRVFLGPYAHRD
GPNYQWVPFQGRVPYPRPGTCPSKTFGGFESTKDLPDDVITFARSHPAMYNPVFPINNRP
IMVKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSIPKETWHDLEEVLLEEM
TVFREPTTISAMELSTKQQQLYVGSAAGVAQLPLHRCDIYGKACAECCLARDPYCAWDGS
SCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHDNHHGHSLEERIIYGVENSSTFLECSP
KSQRALVYWQFQRRNEERKEEVRVDEHLIRTEQGLLLRSLQRRDAGRYLCQAVEHGFMQT
LLRVRLEVIDAEHLDALLPRDGAGAAAREAAPGLTPSQKVWYRDFMQLLSHPHLNTMDEF
CEQVWKRDRKQRRPRPGHAQGGGTKWKHLQESKKGRNRRTHEFERAPRSV
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgggctggtgcaccgggctggtctgtctgctctggggagcgttactcacggcgagagca
aactatcaaaatggcaagaacaacgtgccgaggctgaaattgtcctacaaagaaatgttg
gaatccaacaatgtgatcactttcaatggcttggccaacagctccagttatcataccttc
cttttggatgaggaacggagtaggctctatgttggagcaaaggatcacatattttcattc
aacctggttaatatcaaggattttcaaaagattgcgtggccagtatcttacaccagaagg
gatgaatgcaaatgggctggaaaagacatcctgagagagtgtgccaacttcatcaaggtg
ctcaaggtttacaatcagacgcacttgtacgcctgcggaacgggggctttccacccaatt
tgcacctacgttggaattggacatcatcctgaggacaacatttttaaactggaggactca
cattttgaaaatggccgtgggaagagtccatatgaccccaaactactgacagcatctctt
ttaatagatggagaattgtactctggaactgcggcggattttatggggagagactttgct
atcttccgaacacttggtcagcaccaccccatcaggacggagcagcacgattccaggtgg
ctcaacgatccgaggttcattagcgctcacctcatcccagagagtgacaaccccgaagat
gacaaagtgtacttcttcttccgtgaaaatgccatagacggagaacactctggaaaagcc
actcacgcaagaataggtcagatatgcaagaacgactttgggggacataggagcctggtg
aacaagtggacgaccttcctcaaagccaggctcatctgctcagtgccagggcccaacggc
atcgacactcactttgatgaactgcaggatgtgttcctaatgaactctaaagaccctaag
aatcccattgtctatggcgtgtttacaacttccagtaacatcttcagaggctccgccgtg
tgtatgtacagcatgagtgatgtgcgcagagtcttcctcggtccctacgctcacagggac
ggccccaactaccagtgggtgcctttccaaggaagagtcccctatccaaggccgggaacg
tgtcccagtaaaacgtttggtgggttcgagtctacaaaggacctccctgatgacgtgatc
acctttgctagaagtcatccggccatgtacaatccagtgtttcctattaataaccgcccg
ataatggtcaaaaccgacgtgaattaccagttcacacagattgtagtagaccgggtggac
gcagaagatggccagtacgatgtcatgtttattggaacagatgttgggactgtactgaaa
gtagtgtcaattcctaaagagacctggcatgatttagaagaagttctgctggaagaaatg
acagtttttcgggaaccaactactatttcagcgatggagctctccactaaacagcaacag
ctgtacgtgggatccgcggcgggtgtggcgcagctgcccctgcaccgctgtgacatctac
ggcaaggcctgcgccgagtgctgcctggcccgcgacccctactgcgcctgggacggctcc
tcctgctcgcgctacttccccacggccaagagacgcaccagacgacaagatataagaaat
ggagatccactgactcactgttcagacttacagcaccatgataatcaccatggccacagc
cttgaagagagaatcatctacggggtggagaacagtagcacgttcctggaatgcagtccc
aagtcacagagggccctggtgtactggcagttccagcggcggaatgaagagcgaaaggaa
gaggtccgggtggacgagcacctcatccgcacggagcaggggctcctgctgcgcagcctg
cagcggcgggacgcgggccgctacctgtgccaggccgtggagcacggcttcatgcagacg
ctgctccgcgtgcgcctggaggtcatcgacgccgagcacctggacgcgctgctgccccgg
gacggcgccggcgccgcggcgcgcgaggcggcccccggcctgacgcccagccagaaggtg
tggtaccgggacttcatgcagctcctcagccacccgcacctcaacaccatggacgagttc
tgcgagcaggtgtggaaaagggaccgcaagcagcgccggccgcggccggggcacgcgcag
ggcggcggcaccaagtggaagcacctgcaggagagcaagaagggcaggaaccggaggacc
cacgagttcgagcgggcgccccgcagcgtctga

KEGG   Oryctolagus cuniculus (rabbit): 100359287
Entry
100359287         CDS       T03373                                 
Symbol
SEMA3C
Name
(RefSeq) semaphorin 3C
  KO
K06840  semaphorin 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100359287 (SEMA3C)
SSDB
Motif
Pfam: Sema Ig_3 I-set PSI Ig_2 Ig_6 ig V-set Ribosomal_S5_C
Other DBs
NCBI-GeneID: 100359287
NCBI-ProteinID: XP_008256517
Ensembl: ENSOCUG00000009070
UniProt: A0A5F9DAB9
LinkDB
Position
7:35039304..35224930
AA seq 751 aa
MGFRAICVLFGIFICSVSVKGSSQPQARVYLTFDELRETKTSEYFSLSHHPLDYRILLMD
EDQDRIYVGSKDHILSLNINNISQEPLSVFWPASTIKVEECKMAGKDPTHGCGNFVRVIQ
TFNRTHLYVCGSGAFSPVCTYLNRGRRSEDQVFMIDSKCESGKGRCSFNPNVNTVSVMIN
EELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKV
YFFFKEKLTDNNRSTKQIHSMIARICPNDTGGLRSLVNKWTTFLKARLVCSVTDEDGPET
HFDELEDVFLLETENPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPFAHKEGPN
HQLISYQGRIPYPRPGTCPGGAFTPNLRTTKEFPDDVVTFIRNHPLMYNSIYPIHRRPLI
VRIGTDYKYTKIAVDRVNAADGRYHVLFLGTDRGTVQKVVVLPTNSSANGELILEELEVF
KNRVPITTMKISSKKQQLYVSSNEGISQVSLHRCHIYGTACADCCLARDPYCAWDGHSCS
RFYPTGKRRSRRQDVRHGNPLTQCRGFNLKAYRNAAEIVQYGVKNNTTFLECAPKSPQAS
IKWLLQKGKDRRKEVKLNERIIATSQGLLIRSVQDSDQGLYHCIATENSFKQTIAKINFK
VLDSEMVAVVTDKWSPWTWASSVRALPFHPKDIMGAFSHSEMQMINQYCKDTRQQHYQGE
ESQRMRGDYGKLKALINSRKSRNRRNQLPES
NT seq 2256 nt   +upstreamnt  +downstreamnt
atgggattccgggcgatttgcgtcttgtttggaatatttatttgctctgtctctgtaaaa
ggatcttcccagccccaagcaagagtttatttgacatttgatgagcttcgagaaaccaag
acttctgaatacttcagcctatcccaccacccactagactataggatattattaatggat
gaagatcaagaccggatatatgtgggcagcaaagatcacattctttccttgaatattaac
aacataagtcaagaacctttgagtgttttctggccagcatctacaatcaaagtcgaagaa
tgcaaaatggctggcaaagatcccacacatggctgtgggaactttgtccgtgtcattcag
actttcaatcgcacccatttgtacgtctgcgggagcggtgccttcagcccagtctgtact
tacttgaacagagggaggaggtcggaggaccaagttttcatgattgactccaagtgtgaa
tctggaaaaggccgctgctctttcaaccccaatgtgaacacggtctctgttatgatcaac
gaggagcttttctctgggatgtacatagatttcatgggtacggatgctgccatttttcga
agtttaaccaagagaaatgctgtcagaactgatcagcacaattccaagtggctaagtgaa
cccatgtttgtggacgcacatgtcatccctgatggcaccgatccaaatgatgctaaggtg
tacttcttcttcaaagagaaactaaccgacaacaacaggagtacaaaacagattcattcc
atgattgcaagaatctgtcctaacgacacgggtgggctgcgcagcctggtgaataagtgg
accaccttcttgaaagcgaggctggtgtgctcagtgacggacgaagatggcccggaaact
cacttcgatgaactagaggatgtgtttctcctggaaactgagaatccaaggacaacacta
gtgtatggcatttttacaacatcaagctcggtttttaaaggctccgcggtgtgtgtgtat
cacttgtctgatatacagactgtgttcaatgggccatttgcccacaaagaagggccgaat
catcagctgatttcctatcagggcagaattccttatccccgccctggaacttgccccgga
ggagcatttaccccaaatttgcgaaccaccaaggagtttccagatgacgtggtcacattc
atccgaaaccatccgctcatgtacaattccatctaccccatccaccgacggcctctgatc
gtccgtataggcacagactacaagtacacaaagatcgctgtggatcgagtcaatgctgca
gatggcagataccatgtgctgttcctcggaacagaccgagggactgtgcagaaggtggtg
gtccttcccaccaacagttccgccaacggagagctcattctggaggagctggaagtcttt
aagaatcgtgtccccataacaacaatgaaaatttcatccaaaaagcaacagttatacgtg
agctccaatgaagggatttcccaagtgtctctgcaccgctgccacatctatggcacagcc
tgtgctgactgctgcctggccagggatccgtactgtgcctgggatggccattcctgctcc
aggttctacccaactggaaagcgaaggagtcgaagacaagacgtgagacatggaaatcca
ctgacccagtgcagagggtttaatctaaaagcatatagaaatgcggctgaaattgttcag
tatggagtgaaaaataacaccacgttcctcgagtgtgcccccaagtctccacaggcatcc
atcaagtggttgttacagaagggcaaggacaggaggaaagaggttaagctgaatgaacgc
atcatagccacctcccaaggactcctgatccgctctgttcaagattctgaccaaggactg
tatcactgcattgcaacagaaaacagcttcaagcagaccatagccaagatcaacttcaaa
gttttagattcagaaatggtggctgttgtgacggacaaatggtccccatggacctgggcc
agctctgtgagggccctgcccttccaccccaaggacatcatgggggctttcagccactcg
gaaatgcagatgataaatcagtactgcaaagacactcggcagcaacactaccagggcgag
gagtcacagaggatgagaggggactacggcaagttaaaggccctgatcaacagccggaaa
agtaggaacaggaggaatcagttgccagagtcctaa

DBGET integrated database retrieval system