KEGG   Oryctolagus cuniculus (rabbit): 100338927
Entry
100338927         CDS       T03373                                 
Symbol
SNX1
Name
(RefSeq) sorting nexin 1
  KO
K17917  sorting nexin-1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100338927 (SNX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100338927 (SNX1)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100338927 (SNX1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    100338927 (SNX1)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   100338927 (SNX1)
SSDB
Motif
Pfam: Vps5 Sorting_nexin PX BAR_3_WASP_bdg HR1
Other DBs
NCBI-GeneID: 100338927
NCBI-ProteinID: XP_002718200
Ensembl: ENSOCUG00000005449
LinkDB
Position
17:complement(8103789..8148792)
AA seq 522 aa
MATGGGGCSASERLPPPFPGLESESEGAAGGSEPEAGDSDTEGEDIFTGAAAANKPRSPK
RITSILPINNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKRVPAKTLISPSPQE
AAHSSKPQPSYEELEEEEQEDQFDLTVGITDPEKIGDGMNAYVAYKVTTQTSLPMFRSKQ
FAVKRRFSDFLGLYEKLSEKHSQNGVIVPPPPEKSLIGMTKVKVGKEDSSSAEFLEKRRA
ALERYLQRIVNHPTMLQDPDVREFLEKEELPRASGTQTLSGAGLLKMFNRATDAVSKMTI
KMNESDFWFEEKLQEIECEEQRLRKLHAVVETLVNHRKELALNTAQFAKSLAMLGSSEDN
TALSRALSQLAEVEEKIEQLHQEQASSDFFLLAELLSDYVRLLAVVRAAFDHRMRTWQRW
QDAQATLQKKREAEARLLWANKPDKLQQAKDEITEWESRVTQYERDFERISAVVRKEVIR
FEKEKSKDFKNHVIKYLETLLYSQQQLAKYWEAFLPEAKAIS
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggcgacgggtggtggcggctgtagcgcatcggagagactccctccacccttcccgggc
ctggagtcggagtccgaaggggccgccggggggtcagaacccgaggccggggacagcgac
accgagggggaggacattttcaccggcgccgcggcggccaataagccccgttctccaaag
agaatcacatccattcttcccatcaacaatggctccaaagaaaatgggatccatgaggaa
caagaccaagaaccacaggatctctttgcagatgccacagtggagctttccctggacagc
acacaaaataatcagaagagggtgccggccaaaacgctcatttctccttctccacaggaa
gctgcacattcttctaagccccagccaagctatgaggagctggaggaagaagaacaggag
gaccagtttgatttgacagttggtataactgatcctgagaagataggggacgggatgaat
gcctatgtcgcctacaaagtcacaacacagacgagcctaccaatgttcagaagtaaacaa
tttgcagtaaaaagaagatttagtgactttctgggtctatatgaaaagctgtcagagaaa
cattctcagaatggcgtcattgtccctcctccacccgagaagagcctaataggaatgacg
aaagtgaaagtggggaaggaagattcttcctctgcagaatttcttgaaaaacgaagggcc
gccctagaaaggtaccttcagaggattgtgaaccatcctaccatgttacaggatcctgat
gtcagggagttcttggaaaaagaagagctgccacgcgcctcgggtacccagaccctgagt
ggggctggcctcctcaagatgtttaacagagccacggacgcggtcagcaagatgaccatc
aagatgaacgagtcagacttttggtttgaggagaagctccaggagatagagtgtgaggag
cagcgcttacggaaactgcatgctgttgtagaaactctagtcaaccataggaaagagcta
gcgctgaacacagcccagtttgcaaagagtctggccatgctcgggagctccgaggacaac
acggccctgtcacgggcactctcccagctagccgaggtggaagagaaaatcgagcagctc
caccaggaacaggccagcagtgacttcttcctcctggcggagctcctcagtgactacgtt
cgcctcctggccgtcgtccgcgctgccttcgaccatcgcatgaggacgtggcagcgctgg
caggacgcgcaggccacgctgcagaagaagcgggaggctgaggctcggctgctgtgggcc
aacaagcccgacaagctgcagcaggccaaggacgagatcacagagtgggagtctcgcgtg
acccagtatgaaagggactttgaaaggatctcagcagtggtccgaaaagaagtgatccgg
tttgagaaagagaaatccaaggacttcaaaaaccacgtcatcaagtacctggagacgctc
ctgtactcacagcagcagctggcaaagtactgggaagccttccttcctgaggccaaggct
atctcctaa

KEGG   Oryctolagus cuniculus (rabbit): 100358592
Entry
100358592         CDS       T03373                                 
Symbol
SNX2
Name
(RefSeq) sorting nexin 2
  KO
K17917  sorting nexin-1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100358592 (SNX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100358592 (SNX2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ocu04990]
    100358592 (SNX2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Macropinocytosis
   Sorting nexins
    100358592 (SNX2)
Domain-containing proteins not elsewhere classified [BR:ocu04990]
 Phox homology (PX) domain-containing proteins
  Sorting nexins
   100358592 (SNX2)
SSDB
Motif
Pfam: Vps5 Sorting_nexin PX BAR_3_WASP_bdg FAM92 GrpE DUF3775 Arfaptin HMMR_N DUF4618
Other DBs
NCBI-GeneID: 100358592
NCBI-ProteinID: XP_002710196
Ensembl: ENSOCUG00000013435
LinkDB
Position
3:6978385..7061945
AA seq 519 aa
MAAEREPPPLGDGKPTDFEELEDGEDLFTSTVSTLESSPSSPEPASLPAEDVTANSNGPK
PAEVVLEDDREDLFAEATEEVSLDSPEREPVLSSEPSPAVTPVTPTALIAPRIESKSMSA
PVIFDRSREEIEEEANGDIFDIEIGVSDPEKVGDGMNAYMAYRVTTKTSLSMFSKSEFSV
KRRFSDFLGLHSKLASKYLHVGYIVPPAPEKSIVGMTKVKVGKEDSSSTEFVEKRRAALE
RYLQRTVKHPTLLQDPDLRQFLESSELPRAVNTQALSGAGILRMVTKAADAVNKMTIKMN
ESDAWFEEKQQQFENLDQQLRKLHASVEALVCHRKELSANTAAFAKSAAMLGNSEDHTAL
SRALSQLAEVEEKIDQLHQEQAFADFYMFSELLSDYIRLIAAVKGVFDHRMKCWQKWEDA
QITLLKKRETEAKMMVANKPDKIQQAKNEIREWEAKVQQGERDFEQISKTIRKEVGRFEK
ERVKDFKTVIIKYLESLVQTQQQLIKYWEAFLPEAKAIA
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggcggccgagagggagcctcctccgctgggggacgggaagcccaccgactttgaggag
ctggaggacggagaggacctgttcaccagcacggtgtccaccctggagtcaagtccatcg
tctccagaaccagctagtcttccagcagaagatgttactgcaaactccaatggtcccaaa
cctgcagaagttgtgctagaggatgacagagaagatctctttgcagaagccacagaagaa
gtgtctttggacagccctgaaagggaacctgtcctctcctcagagccttctcccgctgtc
acccctgtcaccccgactgcactcattgctcctaggattgaatcgaagagtatgtctgct
ccagtgatctttgatagatccagggaggagattgaagaagaagcaaatggagatattttt
gatatagaaatcggcgtatcagatccagagaaagttggtgatggcatgaatgcttacatg
gcatacagagtaacaacgaagacttctctttccatgttcagtaagagtgaattttcagtt
aaaagaagattcagtgactttctcggtttgcacagcaaattagcaagcaagtatttacat
gtcgggtatattgtgccaccagctcccgaaaagagcatagtaggtatgaccaaggtcaaa
gtgggtaaagaagactcatcatccacagagtttgtggaaaaacggagagcagctcttgaa
agataccttcaaagaacagtaaaacatccaactttactacaggatcctgatttaaggcag
ttcttggaaagttcagagctgccgagagcagttaatactcaggctctgagtggagcggga
atattgaggatggtgaccaaggccgccgacgctgtcaacaagatgaccatcaagatgaat
gaatcggatgcatggtttgaggaaaagcagcagcagtttgagaatctggatcagcaactt
aggaaacttcatgccagtgttgaagccttggtctgtcacagaaaagaactttcagccaac
acagctgcgtttgctaagagcgctgccatgctggggaattctgaggaccacacggcttta
tctagagctttgtctcagctcgccgaggtcgaggagaagatagaccagttgcatcaagag
caagcctttgctgacttctacatgttctcagagctgctcagtgactacattcgtcttatc
gcggcagtgaagggtgtatttgaccatcggatgaagtgctggcagaaatgggaagatgct
caaattactttgctcaaaaaacgtgaaactgaggccaaaatgatggtcgcaaacaaacca
gataaaatacagcaagcgaaaaacgagataagagagtgggaagcaaaagtacaacaagga
gaaagagattttgaacagatctctaaaacgattcgaaaagaagtaggaagatttgagaaa
gaaagagtaaaggattttaaaactgttatcatcaagtacttagaatcattagtacaaaca
cagcaacagctgataaagtactgggaggcatttcttcctgaagccaaagccattgcctag

DBGET integrated database retrieval system