KEGG   Oryctolagus cuniculus (rabbit): 100339049
Entry
100339049         CDS       T03373                                 
Symbol
ITGB2
Name
(RefSeq) integrin subunit beta 2
  KO
K06464  integrin beta 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04145  Phagosome
ocu04390  Hippo signaling pathway
ocu04514  Cell adhesion molecules
ocu04610  Complement and coagulation cascades
ocu04613  Neutrophil extracellular trap formation
ocu04650  Natural killer cell mediated cytotoxicity
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05140  Leishmaniasis
ocu05144  Malaria
ocu05146  Amoebiasis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05166  Human T-cell leukemia virus 1 infection
ocu05323  Rheumatoid arthritis
ocu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100339049 (ITGB2)
   04390 Hippo signaling pathway
    100339049 (ITGB2)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100339049 (ITGB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100339049 (ITGB2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100339049 (ITGB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    100339049 (ITGB2)
   04613 Neutrophil extracellular trap formation
    100339049 (ITGB2)
   04650 Natural killer cell mediated cytotoxicity
    100339049 (ITGB2)
   04670 Leukocyte transendothelial migration
    100339049 (ITGB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100339049 (ITGB2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100339049 (ITGB2)
   05134 Legionellosis
    100339049 (ITGB2)
   05150 Staphylococcus aureus infection
    100339049 (ITGB2)
   05152 Tuberculosis
    100339049 (ITGB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100339049 (ITGB2)
   05144 Malaria
    100339049 (ITGB2)
   05140 Leishmaniasis
    100339049 (ITGB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100339049 (ITGB2)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100339049 (ITGB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100339049 (ITGB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100339049 (ITGB2)
   04515 Cell adhesion molecules [BR:ocu04515]
    100339049 (ITGB2)
   04090 CD molecules [BR:ocu04090]
    100339049 (ITGB2)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100339049 (ITGB2)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100339049 (ITGB2)
Cell adhesion molecules [BR:ocu04515]
 Integrins
  Integrin beta subunits
   100339049 (ITGB2)
CD molecules [BR:ocu04090]
 Proteins
  100339049 (ITGB2)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 100339049
NCBI-ProteinID: XP_017195795
Ensembl: ENSOCUG00000011544
LinkDB
Position
Un
AA seq 771 aa
MLGWRPLLLALAGLLSLASVLSQECTKYKVSNCRDCIQSGPGCAWCQKLNFTAPGEPDSI
RCDTRDQLRAKGCELDNIVDPRSLAEPQEELDGGRKQLSPQRVTLFLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGRVGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKECQAPFAFRHVLKLTSNSEQFRTEVGKQLISGNLDAPEGGLDAM
MQVAVCPEEIGWRNVTRLLVYATDDGFHFAGDGKLGAILTPNDGQCHLEGNMYRRSNEFD
YPSVGQLAHKLAENNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKDAY
SKLSSRVFLEHSALPDSLRVTYDSFCSKGTLLGQRRGDCDDVQINVPVTFQVKVTASECI
QEKSFVIRALGFTDTVTVRVLPLCECRCRDQRQERGLCGGKGSMECGVCRCDAGYTGKNC
ECQTQGRSSQELEGSCRKDNSSIVCSGLGDCICGQCVCHTSDNPNKQIFGRYCECDNMNC
ERYDGQVCGGKKRGSCSCGQCHCNDGFEGSACQCKKSTDGCLDAQGVECSGRGQCRCNVC
VCKKGYQPPMCQECLGCTSPCGQYISCIECLKFDKGPFGKNCSTQCKNLQLVDVALRGKT
CKTCKEQDSEGCWMAFTLCQRQGMDNYDVHVEDSRECVQGPNIAAIVGGTVAGVVLIGVL
LLVIWKALTHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFTQS
NT seq 2316 nt   +upstreamnt  +downstreamnt
atgctgggctggcgccccctgctgcttgccctggcggggctgctctccctggcctcagtc
ctttcacaggagtgcaccaagtacaaggtcagcaactgccgggactgcatccagtcgggg
cctggctgtgcctggtgccagaagctgaacttcacagcgccgggggagcccgactccatc
cgctgcgacacccgggatcagctgcgggcaaagggctgtgagctggacaacatcgtggac
cccaggagcctggccgagccccaggaggagctggacgggggccggaagcagctgtcccca
cagagagtgacgctgttcctgagaccaggccaggcggctgcgttcaacgtgacgttccgg
cgggccaagggctaccccattgacctgtactacctgatggacctctcctactccatgctc
gacgacctcatcaacgtcaagaagctgggcggagacctgctccgcgccctcaacgagatc
accgagtccggccgtgtcggcttcgggtccttcgtggacaagacggtgctgcccttcgtc
aacacgcaccccgagaagctgaggaacccctgtcccaacaaggagaaggagtgccaggcg
ccctttgccttccggcacgtgctgaagctgaccagcaactccgagcagttccggaccgag
gttggcaagcagctgatctccgggaacctggacgcccccgagggcgggctggacgccatg
atgcaggtcgccgtgtgcccggaggaaatcggctggcgcaatgtcacgcggctgctggtg
tatgccaccgacgacggcttccactttgctggtgatgggaagctgggcgccatcctgacc
cccaatgacggccaatgccacctggagggaaacatgtaccggcgcagcaacgaattcgac
tacccgtcggtggggcagctggcgcacaagctggccgagaacaacatccagcccatcttc
gctgtgaccaagaagatggtgaagacctatgagaaactcacggagatcatccccaagtcg
gccgtcggggagctgtctgaggactccagcaacgtggtgcagctcatcaaggacgcctac
agcaaactgtcgtcccgggtcttcctggagcacagcgccctgcctgactccctgagggtc
acctacgactccttctgcagtaaggggacgctcctgggccagcgcagaggggactgtgac
gacgtgcagatcaacgtcccggtcaccttccaggtgaaggtcacggcctccgagtgcatc
caggagaagtcgtttgtcatccgggccctgggcttcaccgacacggtgacggtgcgggtc
ctccccctgtgtgagtgccggtgccgggaccagaggcaggagcgtggcctgtgcgggggc
aagggctccatggagtgcggcgtctgcaggtgcgacgccggctacaccgggaagaactgt
gagtgccagacgcagggcaggagcagccaggagctggagggaagctgccggaaggacaac
agctccattgtctgctcggggctgggggactgcatctgcgggcagtgcgtgtgccacacc
agcgacaaccccaacaagcagatcttcgggcggtactgcgagtgcgacaacatgaactgt
gagcgctacgacggccaggtctgcggtggcaaaaagagggggtcctgctcctgcggccag
tgccattgcaacgacggcttcgagggctcggcgtgccagtgcaagaagtccacggacggc
tgcctggatgcgcagggcgtggagtgcagcggccgtggacagtgccgttgcaacgtgtgt
gtgtgcaagaaggggtaccagccgcccatgtgccaggagtgcctgggctgcacctcgccc
tgcggccagtacatctcctgcattgagtgcctgaaattcgacaagggcccctttgggaag
aactgcagcacccagtgcaaaaacctgcagctggtggacgtggccctgcggggcaagacg
tgcaagacgtgcaaggagcaagactcggagggctgctggatggccttcaccctgtgccag
cgccaagggatggacaactatgatgtccacgtggaggacagccgagagtgtgtgcagggc
cccaacatcgccgccatcgtcgggggcaccgtggcgggcgttgtgctcatcggcgtcctc
ctgctggtcatctggaaggcactgacccacctgagtgacctccgggagtacaggcgcttt
gagaaggagaagctcaagtcccagtggaacaatgataacccgcttttcaagagtgccacc
accacggtcatgaacccgaagtttacccagagttag

KEGG   Oryctolagus cuniculus (rabbit): 100351865
Entry
100351865         CDS       T03373                                 
Symbol
ITGAM
Name
(RefSeq) integrin alpha-M
  KO
K06461  integrin alpha M
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04015  Rap1 signaling pathway
ocu04145  Phagosome
ocu04514  Cell adhesion molecules
ocu04610  Complement and coagulation cascades
ocu04613  Neutrophil extracellular trap formation
ocu04640  Hematopoietic cell lineage
ocu04670  Leukocyte transendothelial migration
ocu04810  Regulation of actin cytoskeleton
ocu05133  Pertussis
ocu05134  Legionellosis
ocu05140  Leishmaniasis
ocu05146  Amoebiasis
ocu05150  Staphylococcus aureus infection
ocu05152  Tuberculosis
ocu05202  Transcriptional misregulation in cancer
ocu05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100351865 (ITGAM)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100351865 (ITGAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100351865 (ITGAM)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100351865 (ITGAM)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100351865 (ITGAM)
   04610 Complement and coagulation cascades
    100351865 (ITGAM)
   04613 Neutrophil extracellular trap formation
    100351865 (ITGAM)
   04670 Leukocyte transendothelial migration
    100351865 (ITGAM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100351865 (ITGAM)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    100351865 (ITGAM)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100351865 (ITGAM)
   05134 Legionellosis
    100351865 (ITGAM)
   05150 Staphylococcus aureus infection
    100351865 (ITGAM)
   05152 Tuberculosis
    100351865 (ITGAM)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100351865 (ITGAM)
   05140 Leishmaniasis
    100351865 (ITGAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100351865 (ITGAM)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ocu04147]
    100351865 (ITGAM)
   04515 Cell adhesion molecules [BR:ocu04515]
    100351865 (ITGAM)
   04090 CD molecules [BR:ocu04090]
    100351865 (ITGAM)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100351865 (ITGAM)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100351865 (ITGAM)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100351865 (ITGAM)
Cell adhesion molecules [BR:ocu04515]
 Integrins
  Integrin alpha subunits
   100351865 (ITGAM)
CD molecules [BR:ocu04090]
 Proteins
  100351865 (ITGAM)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Adhesion molecules of cell surface
   100351865 (ITGAM)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 Integrin_alpha DUF11
Other DBs
NCBI-GeneID: 100351865
NCBI-ProteinID: XP_002721795
Ensembl: ENSOCUG00000001587
LinkDB
Position
Un
AA seq 1155 aa
MTYRILLLTAVALCHGFNLETENTMTFSRNEKGFGQSVVQFEGSRVVVGAPQEITAPNQT
GGLYQCDYSSNSCDPIQLQVPPEAVNMSLGLSLAASTSPFQLLACGPTMHQFCKENTYVN
GLCFLFGSNLLQSPQRVPETLRGCPQQESDIAFLIDGSGSIDSTDFQRMKEFVSTVMEQF
TKSNSLFALMQYSEEFRTHFTFSDFKRNPNPRALVKPIRQLLGRTHTATGILKVVTELFH
SSSGARANARKVLVVITDGEKFGDTLEYEDVIPRAEREGVIRYVVGVGDAFNSEQSRQEL
NTIASKPSREHVFRVNNFEALNTIRNQLQEKIFAIEGTQSGSTSSFEHEMSQEGFSAAIT
SSGPLLGSVGSFDWAGGAFLHTSKSAVTFINTTRVDSDMNDAYLGYASAVILRNRVKSIV
LGAPRYQHIGLVVMFRQSARVWEVNGEIKGSQIGSYFGSSLCSVDVDRDGSTDLVLIGAP
HYYEQTRGGQVSVCPLPRGQRARWQCERVLSGEQGHPWGRFGAALTVLGDVNGDKLADVA
IGAPGEQENRGAVYLFHGVPGFSISSSHSQRIAGAQLSPRLQYFGQALSGGQDLTQDGLV
DLSVGAKGQVLLLRSQPVLRVEASMEFTPREVARSVFECREQAARVKPAGEVRVCLQVRK
STRDRLREGDIQSTITYDLALDAGRQYPRAIFDRTKNNTGRHTQTLGLTPKCETLKLSLP
DCVEDSVGPIVLRLNFSLVGKPLPTFGNLRPVLAADAQTLFMGMFPFEKNCGSDSICQDD
LSVTFSLNLDTVVVGSPQDFNVTLTVRNEGEDSYRTQVTFDPVGLSYRKVSEVQNQRSQR
SWRLNCESIPSSKDSLTLKNTSCSISHPIFPGNSEVTFNITFYVESDAYLGSKLLLKARV
TSENNMPSTSKSEFQMELPVKYAVYLVVTSGEVSTKYLNFTASEKSTRVLQHEYQFNNLG
QRRLPISVVFWVPVRLQEKTVWDDPQAIFSLNLSSGCHSEERLPPRSDFLAQLNKSPVVN
CSIAVCRRIQCDIPSLSHREQFNVTLQGNLSFDWYIKTAHNHLLLVSAAEILFNQSAFTL
LPGQDAFVRAQTETKVELYQVHDPVPLIVGSSIGGLVLLALITAGLYKLGFFKRQYKDMM
SEAAPQEAPQEAPPQ
NT seq 3468 nt   +upstreamnt  +downstreamnt
atgacttacaggatccttctgctaacagccgtggccttgtgtcatgggttcaacctggag
actgagaacaccatgaccttcagcagaaacgagaagggcttcgggcagagcgtggtccag
tttgaaggctcccgggtggtggttggagctccccaggagataacggctcccaaccaaaca
ggtggcctctaccagtgtgactacagctcgaactcgtgcgatcccatccagctgcaggta
ccccccgaggctgtgaacatgtccctgggcctgtccctggcggcctccaccagccccttt
cagctgctggcctgcggccctactatgcaccagttttgcaaagagaacacgtatgtgaat
ggcctctgcttcctgtttggatccaacctgctgcagtcaccccagagggtcccagagacc
ctcagaggatgtcctcagcaggagagtgacattgccttcctgattgatggctccggtagc
attgactcaacggacttccagaggatgaaggagtttgtctccaccgtgatggagcaattc
acgaagtccaattccctgttcgccttgatgcagtactccgaagagttccggactcacttt
accttcagtgacttcaaaagaaaccccaaccctagagcgctggtgaagccgatccgacag
ctgcttgggaggacgcacacggccacggggatcctcaaagtcgtgacagagctgtttcat
agcagtagcggggccagggcgaacgcccggaaggtcctcgtggtgatcacggatggagag
aagttcggcgacaccttggagtatgaggatgtcatcccgagggcagaaagggagggcgtc
attcgctacgtcgttggggtgggagacgccttcaacagtgagcaaagccgccaagagctc
aataccattgcgtccaagccgtctcgtgagcacgtgttccgggtgaacaacttcgaagcc
ctgaacaccattcggaatcagcttcaggaaaagatctttgcaatcgagggtactcagtca
ggaagtaccagctcttttgagcacgagatgtctcaggaagggttcagcgctgccatcact
tctagtggccccctactgggctctgtggggagctttgattgggctggtggagcttttttg
cacacatccaagagtgccgtcaccttcatcaacaccacgagggtggattcagacatgaac
gatgcttacttgggttacgcctctgcagtcatcttgcggaaccgggtgaagagcatagtt
ctcggggctcctcgctatcagcacatcggcctggtggtgatgttcagacagagcgctcgc
gtctgggaggtcaacggtgaaatcaaaggcagccagatcggctcctacttcgggagctcc
ctctgctccgtggacgtggacagagacggcagcaccgacctggtcctcatcggggccccc
cattactatgagcagacgcgagggggccaggtgtccgtgtgccccttgccccgggggcag
cgggctcggtggcagtgtgagcgtgttctctctggggagcagggccacccctggggccgc
ttcggggcggctctgaccgtgctgggggacgtgaatggggacaagctggcagatgtggcc
atcggggccccaggggagcaggagaaccggggcgctgtctacctgtttcatggagtcccg
ggattcagcatcagctcttcccacagccagcgcatcgcaggtgcccagctgtcccccagg
ctccagtacttcgggcaggcgctcagcgggggtcaggacctcacccaggacggcctggtg
gacctgtctgtaggggccaagggacaggtgctgctgctcaggtcccagccggtgctgaga
gttgaggcgtccatggagttcacacccagggaagtggcaaggagtgtgtttgagtgtcgg
gagcaggccgctcgggtaaagccagccggggaggtccgagtgtgcctccaggtccgcaag
agcacccgggatcggctccgtgaaggagatatccagagcaccatcacttacgacctggcg
ctggacgctggacgccagtatcccagggccatcttcgacaggaccaagaacaacacaggc
agacatacgcagaccctggggctgaccccgaagtgcgagacgttgaagctgtcattaccg
gactgtgtggaggactccgtgggccccatcgtcctgcgtctcaacttctctctggtgggg
aagccgctgcccacttttgggaacctgcggccggtgctggctgcagacgctcagacactc
ttcatgggtatgtttcccttcgagaagaattgtggcagcgacagcatttgccaggatgac
ctcagcgtcaccttcagtctgaacctggacaccgtggtggtgggcagcccccaggacttc
aacgtgaccctgaccgtgagaaatgagggtgaggactcctataggactcaggtgaccttc
gacccagttggcttatcctatcggaaggtgtcagaggttcagaaccagcgttcccaacgc
tcctggcgcctgaactgtgagtccatcccttcctccaaagactccctgaccttgaagaac
acgagctgcagcatcagccaccccatcttccctggcaactcggaggtcacctttaacatc
accttttatgtggagtccgatgcttacctgggaagcaaactgctcctcaaagcccgtgtg
accagtgagaacaacatgcccagcaccagcaaatccgagttccagatggagctgcctgtg
aaatacgctgtctacttggtggtcaccagcggtgaggtctccaccaaatatctcaacttc
acggcttccgagaagagcacgcgggttctgcagcacgaatatcagttcaacaacctgggc
cagaggaggctccccatcagcgtggtgttttgggtgccggtgcggctgcaggagaagacc
gtgtgggacgacccacaggccattttctccctgaacctctccagtgggtgccacagtgag
gagaggcttccgcctcgctctgacttcctggctcagctgaacaagtccccggtggtgaac
tgctccatcgccgtctgtcggaggattcagtgcgacatcccctccctcagccaccgggaa
caattcaacgtcaccctccaaggcaacctctcctttgactggtacattaagacagcgcac
aaccacctcctgctggtgagcgcggcagagattttgttcaaccagtccgctttcaccctg
cttcccggccaggacgcctttgtgagggcccagacggagaccaaggtggagctgtaccag
gttcatgaccctgtgccactcatcgtgggcagctccattggggggctggtgctgctggcc
ctcatcactgccgggctctacaagctcggcttcttcaaacgacagtacaaggacatgatg
agtgaggccgctccccaagaggctccccaagaggctccacctcagtaa

DBGET integrated database retrieval system