KEGG   Oryctolagus cuniculus (rabbit): 100339349
Entry
100339349         CDS       T03373                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 N-like
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100339349
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100339349
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100339349
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100339349
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100339349
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    100339349
SSDB
Motif
Pfam: UQ_con UEV
Other DBs
NCBI-GeneID: 100339349
NCBI-ProteinID: XP_002721463
Ensembl: ENSOCUG00000027922
LinkDB
Position
Un
AA seq 154 aa
MAGLPCRIIKETQCLLAEPIPGIKAEPDESNVRYFHVVIAGPQDFPFEGETFKLELLNFF
PEEYPMAAPKVCFMTKIYHPNVDKLGRMCLDISKDKWSPALQIRTVLLWIQALLSAPNPD
DPLANDAVEQWKTNEAQAIETARARTRLCAMNNI
NT seq 465 nt   +upstreamnt  +downstreamnt
atggccgggctgccctgcaggatcatcaaggaaacccagtgtttgctggcagaaccaatt
cctggcattaaagcagaaccagatgagagcaatgtccgctattttcatgtggtcattgct
ggcccccaggatttcccctttgagggagagacttttaaacttgaacttttaaacttcttt
ccagaagaatacccaatggcagcccctaaagtatgtttcatgaccaaaatttatcatcct
aatgtagacaagttgggaagaatgtgtttagatatttcgaaagataagtggtccccagca
ctgcagatccgcacagttctgctatggatccaggctttgttaagtgctcccaatccagat
gatccattagcaaatgatgcagtggagcagtggaagaccaacgaagcccaagccatagaa
acagctagagcacggactaggctatgtgccatgaataatatttaa

KEGG   Oryctolagus cuniculus (rabbit): 100341684
Entry
100341684         CDS       T03373                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 N-like
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100341684
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100341684
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100341684
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100341684
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100341684
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    100341684
SSDB
Motif
Pfam: UQ_con RWD UEV
Other DBs
NCBI-GeneID: 100341684
NCBI-ProteinID: XP_002711770
Ensembl: ENSOCUG00000012429
LinkDB
Position
5:complement(29892977..29893781)
AA seq 151 aa
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARCFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRSSAIDPALLSAPKPDDPL
ANDVAEQWKTNEAQAIETARARTRLCAVNNI
NT seq 456 nt   +upstreamnt  +downstreamnt
atggccgggctgccccgcaggatcatcaaggaaacccagcgtttgctggcagaaccagtt
cctggcattaaagcagaaccagatgagagcaacgcccgctgttttcatgtggtcattgct
ggcccccaggattccccctttgagggagggacttttaaacttgaactattccttccagaa
gaatacccaatggcagcccctaaagtacgtttcatgaccaaaatttatcatcctaatgta
gacaagttgggaagaatatgtttagatattttgaaagataagtggtccccagcactgcag
atccgcagttctgccatcgatccagctttgttaagtgctcccaaaccagatgatccatta
gcaaatgacgtagcggagcagtggaagaccaacgaagcccaagccatagaaacagctaga
gcacggactaggctatgtgccgtgaataatatttaa

KEGG   Oryctolagus cuniculus (rabbit): 100343655
Entry
100343655         CDS       T03373                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 N
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100343655
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100343655
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100343655
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100343655
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100343655
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    100343655
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 100343655
NCBI-ProteinID: XP_002714242
Ensembl: ENSOCUG00000006757
UniProt: G1T107
LinkDB
Position
12:10816319..10817552
AA seq 152 aa
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
NT seq 459 nt   +upstreamnt  +downstreamnt
atggctgggctgccccgcaggatcatcaaggaaacccagcgtttgctggcagaaccagtt
cctggcattaaagcagaaccagatgagagcaacgcccgctattttcatgtggtcattgct
ggcccccaggattccccctttgagggagggacttttaaacttgaactattccttccagaa
gaatacccaatggcagcccctaaagtacgtttcatgaccaaaatttatcatcctaatgta
gacaagttgggaagaatatgtttagatattttgaaagataagtggtccccagcactgcag
atccgcacagttctgctatcgatccaggctttgttaagtgctcccaatccagatgatcca
ttagcaaatgacgtagcggagcagtggaagaccaatgaagcccaagccatagaaacagct
agagcatggactaggctatatgccatgaataatatttaa

KEGG   Oryctolagus cuniculus (rabbit): 100353764
Entry
100353764         CDS       T03373                                 
Symbol
UBE2N
Name
(RefSeq) ubiquitin conjugating enzyme E2 N
  KO
K10580  ubiquitin-conjugating enzyme E2 N [EC:2.3.2.23]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100353764 (UBE2N)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100353764 (UBE2N)
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100353764 (UBE2N)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100353764 (UBE2N)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100353764 (UBE2N)
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    100353764 (UBE2N)
SSDB
Motif
Pfam: UQ_con UEV RWD
Other DBs
NCBI-GeneID: 100353764
NCBI-ProteinID: XP_002711246
Ensembl: ENSOCUG00000011287
UniProt: G1T107
LinkDB
Position
4:complement(72712099..72751849)
AA seq 152 aa
MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPE
EYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDP
LANDVAEQWKTNEAQAIETARAWTRLYAMNNI
NT seq 459 nt   +upstreamnt  +downstreamnt
atggccgggctgccccgcaggatcatcaaggaaacccagcgtttgctggcagaaccagtt
cctggcattaaagcagaaccagatgagagcaacgcccgctattttcatgtggtcattgct
ggcccccaggattccccctttgagggagggacttttaaacttgaactattccttccagaa
gaatacccaatggcagcccctaaagtacgtttcatgaccaaaatttatcatcctaatgta
gacaagttgggaagaatatgtttagatattttgaaagataagtggtccccagcactgcag
atccgcacagttctgctatcgatccaggctttgttaagtgctcccaatccagatgatcca
ttagcaaatgacgtagcggagcagtggaagaccaatgaagcccaagccatagaaacagct
agagcatggactaggctatatgccatgaataatatttaa

DBGET integrated database retrieval system