KEGG   Oryctolagus cuniculus (rabbit): 100339383
Entry
100339383         CDS       T03373                                 
Symbol
ATF4
Name
(RefSeq) activating transcription factor 4
  KO
K04374  cyclic AMP-dependent transcription factor ATF-4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04137  Mitophagy - animal
ocu04141  Protein processing in endoplasmic reticulum
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04720  Long-term potentiation
ocu04722  Neurotrophin signaling pathway
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04912  GnRH signaling pathway
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04932  Non-alcoholic fatty liver disease
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100339383 (ATF4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100339383 (ATF4)
   04668 TNF signaling pathway
    100339383 (ATF4)
   04022 cGMP-PKG signaling pathway
    100339383 (ATF4)
   04151 PI3K-Akt signaling pathway
    100339383 (ATF4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100339383 (ATF4)
  09143 Cell growth and death
   04210 Apoptosis
    100339383 (ATF4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100339383 (ATF4)
   04922 Glucagon signaling pathway
    100339383 (ATF4)
   04912 GnRH signaling pathway
    100339383 (ATF4)
   04915 Estrogen signaling pathway
    100339383 (ATF4)
   04926 Relaxin signaling pathway
    100339383 (ATF4)
   04935 Growth hormone synthesis, secretion and action
    100339383 (ATF4)
   04918 Thyroid hormone synthesis
    100339383 (ATF4)
   04928 Parathyroid hormone synthesis, secretion and action
    100339383 (ATF4)
   04925 Aldosterone synthesis and secretion
    100339383 (ATF4)
   04927 Cortisol synthesis and secretion
    100339383 (ATF4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100339383 (ATF4)
  09156 Nervous system
   04725 Cholinergic synapse
    100339383 (ATF4)
   04728 Dopaminergic synapse
    100339383 (ATF4)
   04720 Long-term potentiation
    100339383 (ATF4)
   04722 Neurotrophin signaling pathway
    100339383 (ATF4)
  09149 Aging
   04211 Longevity regulating pathway
    100339383 (ATF4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100339383 (ATF4)
   05203 Viral carcinogenesis
    100339383 (ATF4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100339383 (ATF4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100339383 (ATF4)
   05161 Hepatitis B
    100339383 (ATF4)
   05163 Human cytomegalovirus infection
    100339383 (ATF4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100339383 (ATF4)
   05012 Parkinson disease
    100339383 (ATF4)
   05014 Amyotrophic lateral sclerosis
    100339383 (ATF4)
   05020 Prion disease
    100339383 (ATF4)
   05022 Pathways of neurodegeneration - multiple diseases
    100339383 (ATF4)
  09165 Substance dependence
   05030 Cocaine addiction
    100339383 (ATF4)
   05031 Amphetamine addiction
    100339383 (ATF4)
   05034 Alcoholism
    100339383 (ATF4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100339383 (ATF4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100339383 (ATF4)
   04934 Cushing syndrome
    100339383 (ATF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100339383 (ATF4)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100339383 (ATF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DUF4407 DUF3450
Other DBs
NCBI-GeneID: 100339383
NCBI-ProteinID: XP_017197573
LinkDB
Position
4:complement(84044779..84046813)
AA seq 341 aa
MSFLHSAGLAGDLASPFDQAALGAEEGLGLLDDYLEVATPWKPPGPPGDKAAAGSSEWLA
ADGLLGAPADGKEDAFSGTDWMLEKVDLKEFDFDALLSLDDLEAVPDELLATLDDSCDLF
APLALDALKEPPQAGSPLGPLPASLPQVAPCTFLQPLPLSLGVAAASPDESFSLELGSEV
DIADGDRKPESPGLGPVVPQGVKEEDSPSDNDSGVCMSPESCPGSPQRSPSAPTRRGSPH
RGPPAPARPKPYESAAAAAARVKGEKLEKKLKKMEQNKTAATRYRQKKRAEQEALAGECR
GLEERNAALRERADGLAKEIQYLKDLLEEVRAARGRRRVPA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgagcttcctgcacagcgcggggttggcgggggacttggcgtcccccttcgaccaggcg
gctttgggggctgaggagggcctggggctcctggacgactacctggaggtggccacgccc
tggaagcctcccgggccccccggcgacaaggctgcggcgggctcctcggaatggctggcg
gcggacgggctgctgggcgcccccgccgacggcaaggaggacgccttctccgggacggac
tggatgttggagaaagtggacctcaaggagttcgacttcgacgccctgctgagcttggac
gacctggaggccgtgcccgacgagctgctggccacgctggacgactcgtgcgacctcttc
gcccccctggccctggacgcgctcaaggagccgccccaggcagggagcccgctcggcccc
ctccccgcgagcctgccgcaggtcgccccctgcaccttcctgcagcccctgcccctgtcg
ctgggggtcgcggccgcctccccggatgagtcgttcagcttggagctgggcagtgaggtg
gacatcgcggacggggaccggaagcccgagtcgcccggcctgggccccgtggtcccgcag
ggcgtcaaggaggaggacagcccctccgacaacgacagcggcgtctgcatgagccccgag
tcctgcccgggctccccgcagcgcagcccctccgcccccacccgcaggggctccccgcac
aggggcccccccgccccggcccgccccaagccctacgagtctgcggcggccgcggcggcg
cgcgtgaagggcgagaagctggagaagaagctcaagaagatggagcagaacaagacggcc
gccacgcgctaccggcagaagaagcgggcggagcaggaggcgctggcgggcgagtgccgg
gggctggaggagcgcaacgcggccctgcgggagagggccgacggcctggccaaggagatc
cagtacctcaaggacctgctggaggaggtgcgggcggcccgcggcaggaggagggtcccc
gcctag

KEGG   Oryctolagus cuniculus (rabbit): 100343130
Entry
100343130         CDS       T03373                                 
Symbol
CREB3L2
Name
(RefSeq) cAMP responsive element binding protein 3 like 2
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04714  Thermogenesis
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04931  Insulin resistance
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04962  Vasopressin-regulated water reabsorption
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100343130 (CREB3L2)
   04024 cAMP signaling pathway
    100343130 (CREB3L2)
   04022 cGMP-PKG signaling pathway
    100343130 (CREB3L2)
   04151 PI3K-Akt signaling pathway
    100343130 (CREB3L2)
   04152 AMPK signaling pathway
    100343130 (CREB3L2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100343130 (CREB3L2)
   04922 Glucagon signaling pathway
    100343130 (CREB3L2)
   04915 Estrogen signaling pathway
    100343130 (CREB3L2)
   04926 Relaxin signaling pathway
    100343130 (CREB3L2)
   04935 Growth hormone synthesis, secretion and action
    100343130 (CREB3L2)
   04918 Thyroid hormone synthesis
    100343130 (CREB3L2)
   04928 Parathyroid hormone synthesis, secretion and action
    100343130 (CREB3L2)
   04916 Melanogenesis
    100343130 (CREB3L2)
   04925 Aldosterone synthesis and secretion
    100343130 (CREB3L2)
   04927 Cortisol synthesis and secretion
    100343130 (CREB3L2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100343130 (CREB3L2)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100343130 (CREB3L2)
  09156 Nervous system
   04725 Cholinergic synapse
    100343130 (CREB3L2)
   04728 Dopaminergic synapse
    100343130 (CREB3L2)
  09149 Aging
   04211 Longevity regulating pathway
    100343130 (CREB3L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100343130 (CREB3L2)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100343130 (CREB3L2)
   05203 Viral carcinogenesis
    100343130 (CREB3L2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100343130 (CREB3L2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100343130 (CREB3L2)
   05161 Hepatitis B
    100343130 (CREB3L2)
   05163 Human cytomegalovirus infection
    100343130 (CREB3L2)
   05165 Human papillomavirus infection
    100343130 (CREB3L2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100343130 (CREB3L2)
   05020 Prion disease
    100343130 (CREB3L2)
  09165 Substance dependence
   05030 Cocaine addiction
    100343130 (CREB3L2)
   05031 Amphetamine addiction
    100343130 (CREB3L2)
   05034 Alcoholism
    100343130 (CREB3L2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100343130 (CREB3L2)
   04934 Cushing syndrome
    100343130 (CREB3L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100343130 (CREB3L2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100343130 (CREB3L2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf JMY HAUS6_N TPR_MLP1_2
Other DBs
NCBI-GeneID: 100343130
NCBI-ProteinID: XP_002711982
Ensembl: ENSOCUG00000007313
UniProt: A0A5F9CPZ2
LinkDB
Position
7:complement(2108811..2240892)
AA seq 520 aa
MEVLESGEQSVLQWDRKLSELSEPGESEALMYHTHFSELLDEFSQNVLGQLLNDPFLSEK
TVSMEVEPSPTSPAPLIQAEHSYSLCEEPRAQSPFTHVTNSDSFNDEEVESEKWYLSADF
PSTTIKTEPITDEPPPGLVPSVTLTITAISTPYEKEEPSLEVNTGVDSSCQTIIPKIKLE
PHEVDQFLNFSPKEASVDHLHLPPTPPSSHSSDSEGSLSPSPRLHPFSLPQTHSPARAVP
RAPSALSSSPLLTAPHKLQGSGPLVLTEEEKRTLIAEGYPIPTKLPLTKSEEKALKKIRR
KIKNKISAQESRRKKKEYMDSLEKKVESCSTENLELRKKVEVLENTNRTLLQQLQKLQTL
VMGKVSRTCKLAGTQTGTCLMVVVLCFAVAFGSFFQGYGPYPSATKMALPSQHSMPEPYT
ASVVRSRNLLIYEEHSPLEEPSSPASAGELGGWDRGSSLLRVSGLESRADMDLPHFLLSN
ETSLEKSVLSELQQHLVSANLEGNETLKVVELDRRVNTTF
NT seq 1563 nt   +upstreamnt  +downstreamnt
atggaggtgctggagagcggggagcagagcgtcctgcagtgggaccgcaagctgagcgag
ctctcggagcccggggagagcgaggccctcatgtaccacacgcacttctcagaacttctg
gatgaattttcccagaacgtcttgggtcaactcctgaatgaccccttcctctcagaaaag
actgtgtcgatggaggtggagccatcgccgacctcgccggcgcctctcatccaggctgag
cacagctactccctgtgtgaggagccccgggcccagtcgccattcactcacgtgaccaac
agcgacagcttcaatgacgaggaggtggaaagtgagaaatggtacctgtctgcagatttt
ccttcaacaaccatcaagacagagccgattacagatgagccacccccaggacttgttccc
tctgtcactctgaccatcacagccatctctaccccttatgagaaggaagaaccctctctg
gaagtgaatactggggtcgattcctcgtgtcagacaattattcctaagatcaagttggag
cctcatgaagtggatcagttcctcaacttctctcctaaagaagcctccgtggaccacctg
cacttaccgccaaccccccccagcagtcacagcagtgactcggagggcagcctgagcccc
agcccgcgcctgcaccccttcagcctgcctcagacacacagccctgccagggccgtgccc
cgggccccgtctgccctctccagttctcctctcctcacagctccacacaagctgcagggc
tcggggcccctggtcctgacagaggaggagaagaggaccctgattgctgagggctatccc
atccccaccaaactgcccctgacgaaatcagaggagaaggccctgaagaagatccggagg
aaaatcaagaataagatttctgcccaggaaagcaggagaaagaagaaggaatacatggac
agcttggagaaaaaagtggagtcctgttcaactgagaacctggagcttcggaagaaggtg
gaggtcctggagaacaccaacagaactctgcttcagcaactccagaagctgcagaccctg
gtgatgggcaaggtgtctcgtacctgcaagttggctggcacgcagaccggcacctgtctc
atggtcgttgtgctgtgctttgctgttgcctttggtagcttctttcagggctatgggccc
tatccttctgccaccaagatggcgctgcccagccagcattccatgccagagccatacaca
gcatctgtcgtgagatccaggaacctgctgatctatgaagagcattctcccctggaggaa
ccatccagcccagcctcagcaggggagcttgggggctgggacagaggctcctccctgctc
agggtgtcagggctggagtccagagcggacatggatcttcctcatttccttctctcgaat
gagaccagcctggagaagtcagtgctgtcggagctgcagcagcacctagtcagcgctaac
ctggaggggaacgagacgctgaaagtcgtagaactcgacaggagagtgaacaccaccttc
tga

KEGG   Oryctolagus cuniculus (rabbit): 100345475
Entry
100345475         CDS       T03373                                 
Symbol
CREB3L1
Name
(RefSeq) cAMP responsive element binding protein 3 like 1
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04714  Thermogenesis
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04931  Insulin resistance
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04962  Vasopressin-regulated water reabsorption
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100345475 (CREB3L1)
   04024 cAMP signaling pathway
    100345475 (CREB3L1)
   04022 cGMP-PKG signaling pathway
    100345475 (CREB3L1)
   04151 PI3K-Akt signaling pathway
    100345475 (CREB3L1)
   04152 AMPK signaling pathway
    100345475 (CREB3L1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100345475 (CREB3L1)
   04922 Glucagon signaling pathway
    100345475 (CREB3L1)
   04915 Estrogen signaling pathway
    100345475 (CREB3L1)
   04926 Relaxin signaling pathway
    100345475 (CREB3L1)
   04935 Growth hormone synthesis, secretion and action
    100345475 (CREB3L1)
   04918 Thyroid hormone synthesis
    100345475 (CREB3L1)
   04928 Parathyroid hormone synthesis, secretion and action
    100345475 (CREB3L1)
   04916 Melanogenesis
    100345475 (CREB3L1)
   04925 Aldosterone synthesis and secretion
    100345475 (CREB3L1)
   04927 Cortisol synthesis and secretion
    100345475 (CREB3L1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100345475 (CREB3L1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100345475 (CREB3L1)
  09156 Nervous system
   04725 Cholinergic synapse
    100345475 (CREB3L1)
   04728 Dopaminergic synapse
    100345475 (CREB3L1)
  09149 Aging
   04211 Longevity regulating pathway
    100345475 (CREB3L1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100345475 (CREB3L1)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100345475 (CREB3L1)
   05203 Viral carcinogenesis
    100345475 (CREB3L1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100345475 (CREB3L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100345475 (CREB3L1)
   05161 Hepatitis B
    100345475 (CREB3L1)
   05163 Human cytomegalovirus infection
    100345475 (CREB3L1)
   05165 Human papillomavirus infection
    100345475 (CREB3L1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100345475 (CREB3L1)
   05020 Prion disease
    100345475 (CREB3L1)
  09165 Substance dependence
   05030 Cocaine addiction
    100345475 (CREB3L1)
   05031 Amphetamine addiction
    100345475 (CREB3L1)
   05034 Alcoholism
    100345475 (CREB3L1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100345475 (CREB3L1)
   04934 Cushing syndrome
    100345475 (CREB3L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100345475 (CREB3L1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100345475 (CREB3L1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf LMBR1 Jnk-SapK_ap_N Spc29 ELP6 JMY RNase_Y_N UQCC2_CBP6 Prominin TPR_MLP1_2 APG6_N DUF4404 ADIP
Other DBs
NCBI-GeneID: 100345475
NCBI-ProteinID: XP_008268508
LinkDB
Position
1:185637338..185674103
AA seq 519 aa
MDAVLEPFPADRLFPGSSFLDLGDLNESDFLNNAHFPEHLDHFAENMEDFSNDLFSSFFD
DPVLDDKSPLLDMELDSPAPGIQAEHSYSLSGDSAPQSPLVPIKMEDTTQDVEPGAWALG
HKLCSIMVKQEQSPELPVDPLAASSAMATAAAMATTPLLGLSPLSRLPMPPQAPGEMTQL
PVIKAEPQEANQFLKVTPEDLAQMPPTPPSSHGSDSDGSQSPRSLPPSSPVRPMARSSTA
ISTSPLLTAPHKLQGTSGPLLLTEEEKRTLIAEGYPVPTKLPLTKAEEKALKRVRRKIKN
KISAQESRRKKKEYVECLEKKVETFTSENNELWKKVETLENANRTLLQQLQKLQTLVTNK
ISRPYKMAATQTGTCLMVAALCFVLVLGSLVPCLPEFSSGSQTVKEDPITDSVYTASQMP
SRSLLFYDEGAGSWEDTRSALLPVEPPDGWEMKPGGPAEPRPQDHLQHDHLDSTHETTKY
LREAWPEDVGSNSSSPDFSHPEEWFHNRDLGPNTTIKLS
NT seq 1560 nt   +upstreamnt  +downstreamnt
atggacgccgtcctggagcccttcccggccgacaggctgttccccggatccagcttcctg
gacctgggggatctcaacgagtcggatttcctcaacaatgcgcactttcccgagcacctg
gaccactttgccgagaacatggaggacttctccaacgacctgttcagcagcttctttgat
gaccctgtgctggatgacaagagccctctactggacatggagctggactccccggcgcca
ggcatccaggctgagcacagctactccctgagcggggactcagcgccccagagccctctt
gtgcccatcaagatggaggacaccacccaagatgtggaacccggagcctgggcactagga
cacaaactgtgctccatcatggtgaagcaggagcagagcccggagctgcccgtggaccct
ctggccgcctcctcggccatggccaccgccgcggccatggccaccaccccactgctgggc
ctcagccccctgtccaggctgcccatgcccccccaggccccaggagagatgactcagctg
ccagtgatcaaagcagagccccaggaggcgaaccagttcctcaaagtgacaccagaggac
ctggcccagatgcctccgacgccccccagcagccacggcagcgacagtgacggctcgcag
agtccccgctctctgcccccctccagccctgtccggcccatggcccgctcctccacggcc
atctccacctccccactcctcaccgcccctcacaaactccaggggacatccgggccactg
ctgctgaccgaggaggagaagcgcaccctgatcgctgagggctaccccgtccccaccaag
ctccccctcaccaaggccgaggagaaggccctgaagagggtgcggaggaaaatcaagaac
aagatctcagcccaggagagccgccggaagaagaaggagtatgtggagtgcctagaaaag
aaagtagagactttcacgtcggagaacaacgagctgtggaagaaggtggagaccctggaa
aacgccaacaggaccctgctccagcagctgcagaagctgcagactctggtcaccaacaag
atctccaggccttacaagatggccgccacgcagaccgggacctgcctcatggtggcagcc
ctgtgcttcgtcctggtgctgggctccctcgtgccctgcctgcctgagttctcatccggc
tcccagactgtgaaggaagaccccatcacggacagcgtctacacggccagccagatgccc
tcccggagcctcctgttctacgatgaaggggcgggctcctgggaagacacccgcagcgcc
ctgctgcccgtggagcccccggatggctgggaaatgaagccgggggggccggctgagccg
cggccccaggaccacctgcagcacgaccacctggacagcacccatgagaccaccaagtac
ctgagggaagcctggcccgaagacgtcggcagcaacagcagcagccctgacttctcccac
cccgaggagtggttccacaacagggacctgggccccaacaccaccatcaaactctcctag

KEGG   Oryctolagus cuniculus (rabbit): 100351999
Entry
100351999         CDS       T03373                                 
Symbol
CREB1
Name
(RefSeq) cAMP responsive element binding protein 1
  KO
K05870  cyclic AMP-responsive element-binding protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04380  Osteoclast differentiation
ocu04612  Antigen processing and presentation
ocu04668  TNF signaling pathway
ocu04710  Circadian rhythm
ocu04713  Circadian entrainment
ocu04714  Thermogenesis
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04924  Renin secretion
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04931  Insulin resistance
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04962  Vasopressin-regulated water reabsorption
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05152  Tuberculosis
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100351999 (CREB1)
   04024 cAMP signaling pathway
    100351999 (CREB1)
   04022 cGMP-PKG signaling pathway
    100351999 (CREB1)
   04151 PI3K-Akt signaling pathway
    100351999 (CREB1)
   04152 AMPK signaling pathway
    100351999 (CREB1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    100351999 (CREB1)
  09152 Endocrine system
   04911 Insulin secretion
    100351999 (CREB1)
   04922 Glucagon signaling pathway
    100351999 (CREB1)
   04915 Estrogen signaling pathway
    100351999 (CREB1)
   04926 Relaxin signaling pathway
    100351999 (CREB1)
   04935 Growth hormone synthesis, secretion and action
    100351999 (CREB1)
   04918 Thyroid hormone synthesis
    100351999 (CREB1)
   04928 Parathyroid hormone synthesis, secretion and action
    100351999 (CREB1)
   04916 Melanogenesis
    100351999 (CREB1)
   04924 Renin secretion
    100351999 (CREB1)
   04925 Aldosterone synthesis and secretion
    100351999 (CREB1)
   04927 Cortisol synthesis and secretion
    100351999 (CREB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100351999 (CREB1)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100351999 (CREB1)
  09156 Nervous system
   04725 Cholinergic synapse
    100351999 (CREB1)
   04728 Dopaminergic synapse
    100351999 (CREB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100351999 (CREB1)
  09149 Aging
   04211 Longevity regulating pathway
    100351999 (CREB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    100351999 (CREB1)
   04713 Circadian entrainment
    100351999 (CREB1)
   04714 Thermogenesis
    100351999 (CREB1)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100351999 (CREB1)
   05203 Viral carcinogenesis
    100351999 (CREB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100351999 (CREB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100351999 (CREB1)
   05161 Hepatitis B
    100351999 (CREB1)
   05163 Human cytomegalovirus infection
    100351999 (CREB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100351999 (CREB1)
   05165 Human papillomavirus infection
    100351999 (CREB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100351999 (CREB1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100351999 (CREB1)
   05020 Prion disease
    100351999 (CREB1)
  09165 Substance dependence
   05030 Cocaine addiction
    100351999 (CREB1)
   05031 Amphetamine addiction
    100351999 (CREB1)
   05034 Alcoholism
    100351999 (CREB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100351999 (CREB1)
   04934 Cushing syndrome
    100351999 (CREB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100351999 (CREB1)
   03029 Mitochondrial biogenesis [BR:ocu03029]
    100351999 (CREB1)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100351999 (CREB1)
Mitochondrial biogenesis [BR:ocu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100351999 (CREB1)
SSDB
Motif
Pfam: pKID bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 100351999
NCBI-ProteinID: XP_002712648
Ensembl: ENSOCUG00000005427
UniProt: G1SNW9
LinkDB
Position
7:148424446..148501142
AA seq 341 aa
MTMESGAENQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPN
GQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQISTIAESEDSQESVDSVTD
SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSG
QYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQV
VVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAAREC
RRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD
NT seq 1026 nt   +upstreamnt  +downstreamnt
atgaccatggaatctggagcagagaaccagcagagtggagatgcagctgtaacagaagct
gaaaaccaacaaatgacagttcaagcccagccacagattgccacattagcccaggtatct
atgccagcagctcatgcaacatcatctgctcccactgtaacattagtacaactgcccaat
gggcagacagttcaagtccatggagttattcaggcggcccagccatcagttattcagtct
ccacaagtccaaacagttcagtcttcctgtaaggacttaaaaagacttttctccggaaca
cagatttcaactattgcagaaagtgaagattcacaggagtcagtggatagtgtaactgat
tcccaaaaacgaagggaaattctttcaaggaggccttcctacaggaaaattttgaatgat
ttatcttctgatgcaccaggagtgccaaggattgaagaagagaaatctgaagaggagact
tcagcacctgctatcaccactgtaacggtgccaactccgatttaccaaactagcagtgga
cagtatattgccattacccagggaggagcaatacaactggctaacaatggtaccgatggg
gtacagggcctgcaaacattaaccatgaccaatgcagctgccactcagccgggtactacc
attctacagtatgcacagaccacggatggacaacagatcttagtgcccagcaaccaagtt
gttgttcaagctgcttctggagatgtacaaacataccagatccgcacagcacccactagc
accattgcccctggagttgttatggcttcctccccagcacttcctacacagcctgcagaa
gaagcagcacggaagagagaggttcgtctaatgaagaacagggaagcagcgcgagagtgc
cgcaggaagaagaaggagtacgtgaagtgtctagagaacagagtggcggtgctcgaaaac
caaaacaagacgctgattgaggagctgaaagcactcaaggacctttactgccacaaatca
gattaa

KEGG   Oryctolagus cuniculus (rabbit): 100355367
Entry
100355367         CDS       T03373                                 
Symbol
ATF2
Name
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04010  MAPK signaling pathway
ocu04022  cGMP-PKG signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04714  Thermogenesis
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100355367 (ATF2)
   04668 TNF signaling pathway
    100355367 (ATF2)
   04022 cGMP-PKG signaling pathway
    100355367 (ATF2)
   04151 PI3K-Akt signaling pathway
    100355367 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100355367 (ATF2)
   04922 Glucagon signaling pathway
    100355367 (ATF2)
   04915 Estrogen signaling pathway
    100355367 (ATF2)
   04926 Relaxin signaling pathway
    100355367 (ATF2)
   04935 Growth hormone synthesis, secretion and action
    100355367 (ATF2)
   04918 Thyroid hormone synthesis
    100355367 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    100355367 (ATF2)
   04925 Aldosterone synthesis and secretion
    100355367 (ATF2)
   04927 Cortisol synthesis and secretion
    100355367 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100355367 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    100355367 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway
    100355367 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100355367 (ATF2)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100355367 (ATF2)
   05203 Viral carcinogenesis
    100355367 (ATF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100355367 (ATF2)
   05161 Hepatitis B
    100355367 (ATF2)
   05163 Human cytomegalovirus infection
    100355367 (ATF2)
  09164 Neurodegenerative disease
   05020 Prion disease
    100355367 (ATF2)
  09165 Substance dependence
   05030 Cocaine addiction
    100355367 (ATF2)
   05031 Amphetamine addiction
    100355367 (ATF2)
   05034 Alcoholism
    100355367 (ATF2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100355367 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100355367 (ATF2)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100355367 (ATF2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Other DBs
NCBI-GeneID: 100355367
NCBI-ProteinID: XP_008256994
Ensembl: ENSOCUG00000012156
LinkDB
Position
7:complement(114708452..114815057)
AA seq 505 aa
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKADVGATSVLTPM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgaaattcaaattacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgcactgcccctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaactccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcaagtccatttgagaatgaattcaagaaagcttca
gaagacgacattaaaaaaatgcctctagatttatcccctcttgcaacacccatcataaga
agtaaaattgaggagccttctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgaaaaggaggtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgat
tcaagtgtaattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctccaataggccaattgttcctgtgccaggcccatttcctcttctattgcat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgta
catgttccagctgcagtcccacttgttcgaccagtcaccatggtgcctagtgttccagga
atcccaggtccttcttcccctcaaccagtgcagtcagaagcaaaaatgagattaaaggcg
gctttgacccagcagcatcctccagttaccaatggtgatactgtcaaaggtcatggtagc
ggattggttaggactcagtcagaggaatctcgaccacagtcgttgcaacagccagccaca
tctacaacagaaactccggcctctccagctcatacaactccacagacccaaaatacaagc
ggtcgtcgaagaagagcagctaacgaagatcctgatgagaaaaggagaaagtttctagag
cgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagcggaagacttgagttcattaaatggtcagctgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagacgatagttcagaagac
ctttcagtgccgagcagtccacatacagaagcaatacagcatagttctgtcagcacatcc
aatggggtcagttccacctccaaagcagacgtgggagccacttcagtcctcaccccgatg
gcggaccagagcacggagcctgcgctgtcgcagattgtcatggctccttcctcccagtca
cagccctcaggaagttga

KEGG   Oryctolagus cuniculus (rabbit): 100357483
Entry
100357483         CDS       T03373                                 
Symbol
CREB5
Name
(RefSeq) cAMP responsive element binding protein 5
  KO
K09047  cyclic AMP-responsive element-binding protein 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04714  Thermogenesis
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04931  Insulin resistance
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04962  Vasopressin-regulated water reabsorption
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100357483 (CREB5)
   04024 cAMP signaling pathway
    100357483 (CREB5)
   04022 cGMP-PKG signaling pathway
    100357483 (CREB5)
   04151 PI3K-Akt signaling pathway
    100357483 (CREB5)
   04152 AMPK signaling pathway
    100357483 (CREB5)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100357483 (CREB5)
   04922 Glucagon signaling pathway
    100357483 (CREB5)
   04915 Estrogen signaling pathway
    100357483 (CREB5)
   04926 Relaxin signaling pathway
    100357483 (CREB5)
   04935 Growth hormone synthesis, secretion and action
    100357483 (CREB5)
   04918 Thyroid hormone synthesis
    100357483 (CREB5)
   04928 Parathyroid hormone synthesis, secretion and action
    100357483 (CREB5)
   04925 Aldosterone synthesis and secretion
    100357483 (CREB5)
   04927 Cortisol synthesis and secretion
    100357483 (CREB5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100357483 (CREB5)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100357483 (CREB5)
  09156 Nervous system
   04725 Cholinergic synapse
    100357483 (CREB5)
   04728 Dopaminergic synapse
    100357483 (CREB5)
  09149 Aging
   04211 Longevity regulating pathway
    100357483 (CREB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    100357483 (CREB5)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100357483 (CREB5)
   05203 Viral carcinogenesis
    100357483 (CREB5)
  09162 Cancer: specific types
   05215 Prostate cancer
    100357483 (CREB5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357483 (CREB5)
   05161 Hepatitis B
    100357483 (CREB5)
   05163 Human cytomegalovirus infection
    100357483 (CREB5)
   05165 Human papillomavirus infection
    100357483 (CREB5)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100357483 (CREB5)
   05020 Prion disease
    100357483 (CREB5)
  09165 Substance dependence
   05030 Cocaine addiction
    100357483 (CREB5)
   05031 Amphetamine addiction
    100357483 (CREB5)
   05034 Alcoholism
    100357483 (CREB5)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100357483 (CREB5)
   04934 Cushing syndrome
    100357483 (CREB5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100357483 (CREB5)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    100357483 (CREB5)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB TolA_bind_tri DUF6262 NDUFB11 DivIC
Other DBs
NCBI-GeneID: 100357483
NCBI-ProteinID: XP_008259788
Ensembl: ENSOCUG00000003639
LinkDB
Position
10:13143406..13493756
AA seq 474 aa
MIHRHKHEMTLKFPSIKTDNMLSDQTPTPTRFLKNCEEVGLFTELDCSLEHEFRKAQEEE
SSKRNISMHNTVGGAMTGPGTHQLGSSRMASHDTSVVIQQAMPSPQSSSVITQAPSTNRQ
IGPVPGSLSSLLHLHNRQRQPMPASMPGTLPNPTMPGSSAVLMPMERQMSVNSGILGMQG
PNLSEPCASPQVQPMHSEAKMRVKAALTHHPAAMANGNMNTMGHVMEMMGSRQDQAPHHH
MHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHP
PLHTGNQAQVSPATQQMQPTQTIQPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQ
KRKVWVMSLEKKAEELTQTNMQLQNEVSMLKNEVAQLKQLLLTHKDCPITAMQKESQGYL
SPESSPPPSPVPACSQQQVIQHNTITTSSSVSEVVGSSTLSQLTSHRTDLNPIL
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgattcataggcacaagcatgaaatgactttgaagttcccctccataaaaacagacaat
atgttatcagatcagactccgacgcctacgagattcctgaagaactgcgaggaggtgggc
ctcttcaccgagctggactgctcgctggagcatgagttccgcaaggcccaggaggaggag
agcagcaagcggaacatctccatgcataatacagttggtggcgccatgacagggcccgga
acccaccagcttggcagcagccgcatggccagtcacgacaccagcgttgtgatccagcaa
gccatgccgtcaccgcagtccagctcggtcatcacacaggcgccatccaccaaccgccag
atcgggcctgtcccaggctctctgtcttctttgctacacctccacaacagacagagacag
cccatgcccgcctccatgcccgggaccctgcccaaccctacgatgcctggctcttctgcc
gtcttaatgccaatggagagacagatgtcagtgaactccggcatcctgggcatgcaaggg
cccaacctgagcgagccctgtgcttccccccaggtccagccaatgcactcggaagccaaa
atgagggtgaaggccgcactgactcaccacccggctgccatggcgaacgggaacatgaac
accatgggccacgtgatggaaatgatgggttcccggcaggaccaggcgccgcaccatcac
atgcactcccacccacaccagcaccagacgctgcctccccaccacccctacccacaccag
caccagcacccagcgcaccatcctcacccgcagccccaccaccagcaaaaccacccccat
catcactcccactcccacctccacgcacatccagcacatcaccagacctcgccacacccg
cccctgcacaccggcaaccaagcacaggtctcaccagcaacgcaacagatgcagcccacc
cagacgatacagccccagcccacaggggggcgccggcgaagggtggtggacgaggatcct
gatgagaggcggcggaagtttctggaacggaaccgggcggccgccacccgctgcagacag
aagaggaaggtctgggtgatgtcactggaaaagaaagcagaagaactcacccagacaaac
atgcagcttcagaatgaggtgtccatgttgaaaaacgaggtggcccaactgaaacagctg
ttgttaacacacaaagattgtcctataacagccatgcaaaaagaatcccaaggctatcta
agtccagagagtagccctcctccaagccctgtcccagcctgctcccaacagcaagtcatc
cagcataacaccatcaccacgtcctcgtcggtcagtgaggtcgtgggaagctccaccctc
agtcagctcacctctcacagaacagacctgaatcccatcctttaa

KEGG   Oryctolagus cuniculus (rabbit): 100357489
Entry
100357489         CDS       T03373                                 
Symbol
ATF6B
Name
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04141  Protein processing in endoplasmic reticulum
ocu04151  PI3K-Akt signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04918  Thyroid hormone synthesis
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100357489 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100357489 (ATF6B)
   04022 cGMP-PKG signaling pathway
    100357489 (ATF6B)
   04151 PI3K-Akt signaling pathway
    100357489 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100357489 (ATF6B)
   04915 Estrogen signaling pathway
    100357489 (ATF6B)
   04926 Relaxin signaling pathway
    100357489 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    100357489 (ATF6B)
   04918 Thyroid hormone synthesis
    100357489 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    100357489 (ATF6B)
   04925 Aldosterone synthesis and secretion
    100357489 (ATF6B)
   04927 Cortisol synthesis and secretion
    100357489 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100357489 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    100357489 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    100357489 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100357489 (ATF6B)
   05203 Viral carcinogenesis
    100357489 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357489 (ATF6B)
   05161 Hepatitis B
    100357489 (ATF6B)
   05163 Human cytomegalovirus infection
    100357489 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    100357489 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    100357489 (ATF6B)
   05031 Amphetamine addiction
    100357489 (ATF6B)
   05034 Alcoholism
    100357489 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100357489 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100357489 (ATF6B)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100357489 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB DUF4407 bZIP_Maf GIT_CC YabA Docking NYD-SP28_assoc
Other DBs
NCBI-GeneID: 100357489
NCBI-ProteinID: XP_002714342
Ensembl: ENSOCUG00000023089
LinkDB
Position
12:complement(20902426..20912542)
AA seq 698 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYAGLDEVADEPAQLFPCPEQDVPFDS
SSLDVGMDASPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLNSESSHFSAVESLEAIGVGE
VLHVKTESLAPPLCLLGDDPAPPFEIVQINVGSTSDDPSDVQTKTEPVSPSSSVHSEASL
LSADTPHQAFLGEEVLEVKTESPSPPGCLVWDVPAPSFGAVQISMGPSSDGSSDRAPPPR
KPPLQPKPVVLTTVPMPPRAVPPSTAVLLQPLVQPPAVSPVVLIQGAIRVQPEGPVPPVP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSINEPP
SAPAAPRMAREQPRPQRHLLEFSEQEPVQEVERTQGSSRGPEEPQASPAGQPSFRNLTAF
PGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKTPQRAQERQKA
QPRKKSPPVRTIPTQPLGPPERNSEGQLQLYRRPDRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGASGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPAQAPGNTTASAAGQARQASPPPLYLNHP
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggcggagctaatgctcctcagcgagattgcggacccgacgcgtttcttcaccgacaac
ctgctgagcccggaggactggggtctgcggaacagcaccttgtacgccggcctggatgaa
gtggccgacgagccggcgcagctttttccttgcccagaacaggatgtcccgtttgacagc
agctctctggatgtggggatggatgccagcccacctgagcccccctgggaccctctgcct
atcttcccggatcttcaggtgaagtctgagccgtcctccccctgttcttcctcctctctc
aactcggagtcatcacacttctccgcagtggagtcgttagaagcgataggagtaggggag
gtgctgcacgtgaagacagaatccttggcgcccccgctgtgcctcctgggagatgatcca
gcacccccatttgagatcgtccagatcaatgtgggctccacttctgatgacccctcagac
gtccagaccaagacagaacctgtctctccctcttcctcggtgcactctgaggcctccctg
ctctcagcagacaccccgcaccaggctttcctaggagaggaggtgctggaggtgaagacg
gagtccccgtcgcctccgggatgcctggtctgggatgtgcccgcgccctcatttggagct
gtccagatcagcatgggcccatcctcggatggctcttcagacagagccccacccccccgg
aagccaccgctgcagcctaaacctgtggtgctaaccactgtcccgatgccaccccgagct
gtgcctcccagtaccgctgtcctcctgcagcccctcgtccagccacctgcagtgtcccca
gttgtcctcatccagggtgctatccgagtccagcctgaagggccagtcccccctgttcca
aggcctgagaggaagagcatcgtcccggctcccatgcctgggaactcctgcccgcctgaa
gtagacgcgaagctgctgaagcggcagcagcggatgatcaagaaccgggaatcggcctgc
cagtcccggaggaagaagaaggagtacctgcaggggctggaggcgcggctgcaggccgtg
ctggccgacaaccagcagctgcgccgggagaacgctgccctccgccggcggctggaggcc
ctgctggccgagaacagtgagctcaagctgggctccggaaaccggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaactttggacctgtcagcatcaatgagcctcct
tcagcccccgccgctccgcggatggccagggagcagcctcggccccagagacacttgctg
gagttctcggagcaagagccagtgcaggaggttgagcgcacccaggggtcctcccgaggc
cccgaggagccccaggccagccctgcaggccagcccagtttcaggaacctgaccgccttc
cctgggggcaccaaggagctcctgctgagagacctggaccagctcttcctctcctccgac
tgccggcacttcaaccgcactgagtccctcaggcttgccgacgagctcagtggctgggtc
cagcgccaccagagaggccggcggaagacccctcagagggcccaggagagacagaaggct
cagccgcggaagaaatcgcctccagttaggacaatccccacccaacccctgggcccccca
gaaaggaactccgagggccagctgcagctctaccgccgccccgaccgctcgcagccagag
tttctggatgccatcgaccggcgggaagacaccttttatgttgtttccttccgaagggac
cacctgctgctgcccgccatcagccacaacaagacctcccggcctaagatgtccctggtg
atgcctgccatggcccccaacgagaccctgtcgggtcggggagcctccggggactatgaa
gagatgatgcagatcgagtgcgaggtcatggacaccagggtgattcacatcaagacctcc
acggtgcccccctcgctgcgcaagcagcctgcccaggccccaggcaacaccacggcgtcg
gcagccggccaggcccgacaggcctcccccccgcccctctacctcaatcacccctga

KEGG   Oryctolagus cuniculus (rabbit): 100357876
Entry
100357876         CDS       T03373                                 
Symbol
CREB3
Name
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04714  Thermogenesis
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04931  Insulin resistance
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04962  Vasopressin-regulated water reabsorption
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100357876 (CREB3)
   04024 cAMP signaling pathway
    100357876 (CREB3)
   04022 cGMP-PKG signaling pathway
    100357876 (CREB3)
   04151 PI3K-Akt signaling pathway
    100357876 (CREB3)
   04152 AMPK signaling pathway
    100357876 (CREB3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100357876 (CREB3)
   04922 Glucagon signaling pathway
    100357876 (CREB3)
   04915 Estrogen signaling pathway
    100357876 (CREB3)
   04926 Relaxin signaling pathway
    100357876 (CREB3)
   04935 Growth hormone synthesis, secretion and action
    100357876 (CREB3)
   04918 Thyroid hormone synthesis
    100357876 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    100357876 (CREB3)
   04916 Melanogenesis
    100357876 (CREB3)
   04925 Aldosterone synthesis and secretion
    100357876 (CREB3)
   04927 Cortisol synthesis and secretion
    100357876 (CREB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100357876 (CREB3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100357876 (CREB3)
  09156 Nervous system
   04725 Cholinergic synapse
    100357876 (CREB3)
   04728 Dopaminergic synapse
    100357876 (CREB3)
  09149 Aging
   04211 Longevity regulating pathway
    100357876 (CREB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    100357876 (CREB3)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100357876 (CREB3)
   05203 Viral carcinogenesis
    100357876 (CREB3)
  09162 Cancer: specific types
   05215 Prostate cancer
    100357876 (CREB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100357876 (CREB3)
   05161 Hepatitis B
    100357876 (CREB3)
   05163 Human cytomegalovirus infection
    100357876 (CREB3)
   05165 Human papillomavirus infection
    100357876 (CREB3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100357876 (CREB3)
   05020 Prion disease
    100357876 (CREB3)
  09165 Substance dependence
   05030 Cocaine addiction
    100357876 (CREB3)
   05031 Amphetamine addiction
    100357876 (CREB3)
   05034 Alcoholism
    100357876 (CREB3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100357876 (CREB3)
   04934 Cushing syndrome
    100357876 (CREB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100357876 (CREB3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100357876 (CREB3)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf
Other DBs
NCBI-GeneID: 100357876
NCBI-ProteinID: XP_017194592
Ensembl: ENSOCUG00000028989
LinkDB
Position
1:complement(18199919..18204168)
AA seq 375 aa
MSQMELALDPGDQDLLAFLLEQSGAWGEAADESVEAPPDWELPLSEVLSDWEAEDLLSTL
LSPPASLADLSSCEPSPVHHDHTYSLPQEHVSVDVDSGSYGKEEAPMTPLYVEEPTEQEV
ARLVLTEEEKRLLEKEGLTLPGTLPLTKMEEQVLKRVRRKIRNKKSAQESRRKKKVYVGG
LESRVSKYTAQNLELQHKVQLLEEQNLSLLDQLRKLQALVMEISNKTSSGSTCVLVLLFS
FCLLLVPAMYSSDTRGRLPAEHAVLSRQLRALPSEDSHQLDLSALPSEVPKDNTNQLLVS
SDHVLPAPGNSSCLLYYMPQPPDAEPPLTWPFPGLFSEAPCPDPILPLQANLTRNEGQLP
AHSPSSVILQGRYSG
NT seq 1128 nt   +upstreamnt  +downstreamnt
atgtcgcagatggagctggcgttggaccctggcgatcaggacctgctcgctttcctgctc
gagcagagcggagcatggggggaggcagccgatgagtcggtggaggcgcccccggattgg
gagctgccgctttccgaggtactgagcgactgggaggcagaggatctgctgagcaccctg
ctgagtcccccggcgtcgttggccgacctcagctcctgcgagccctcgcctgtgcaccac
gatcacacttactccctcccacaggagcatgtctccgtggacgtagatagtgggagctat
gggaaggaggaggctccgatgactccgctgtatgtggaggagccaacagagcaggaggtt
gctaggctggtactgaccgaggaggagaagaggctactggagaaggaggggcttactctg
cctggaacgcttcctctcaccaagatggaggaacaagttctgaaacgagtgcggcggaag
attcgaaacaaaaagtctgctcaggagagccgcaggaagaagaaggtgtacgtggggggt
ttagagagcagggtatcgaaatacacagcccagaatctggagctccagcataaagtgcag
ctcctggaggaacagaatctgtccctcctcgatcagctgaggaaactgcaggccctagtg
atggagatatcaaacaagaccagcagcggcagcacctgtgtgctggtcctgctgttctcc
ttctgcctcctcctcgttcctgctatgtactcctccgacacgagggggcgcctgccggct
gagcacgcagtgttgtcacgtcagcttcgtgccctccccagtgaggactctcaccagctg
gacctgtctgccctgccgtcagaggtacccaaggacaacacaaaccaattgctggtcagc
tcagaccatgtgctcccagcccctggcaactcttcctgcctgctgtactatatgcctcag
cctcctgatgcagagcctcccctaacgtggccgttccctggcctcttctcagaggccccc
tgcccagaccctatccttcccctgcaggcaaatctcacgagaaatgagggacagctcccc
gcccacagcccgtcatctgtcatcttgcagggcagatactcaggttag

KEGG   Oryctolagus cuniculus (rabbit): 100358175
Entry
100358175         CDS       T03373                                 
Symbol
CREB3L4
Name
(RefSeq) cAMP responsive element binding protein 3 like 4
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04022  cGMP-PKG signaling pathway
ocu04024  cAMP signaling pathway
ocu04151  PI3K-Akt signaling pathway
ocu04152  AMPK signaling pathway
ocu04211  Longevity regulating pathway
ocu04261  Adrenergic signaling in cardiomyocytes
ocu04668  TNF signaling pathway
ocu04714  Thermogenesis
ocu04725  Cholinergic synapse
ocu04728  Dopaminergic synapse
ocu04911  Insulin secretion
ocu04915  Estrogen signaling pathway
ocu04916  Melanogenesis
ocu04918  Thyroid hormone synthesis
ocu04922  Glucagon signaling pathway
ocu04925  Aldosterone synthesis and secretion
ocu04926  Relaxin signaling pathway
ocu04927  Cortisol synthesis and secretion
ocu04928  Parathyroid hormone synthesis, secretion and action
ocu04931  Insulin resistance
ocu04934  Cushing syndrome
ocu04935  Growth hormone synthesis, secretion and action
ocu04962  Vasopressin-regulated water reabsorption
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05030  Cocaine addiction
ocu05031  Amphetamine addiction
ocu05034  Alcoholism
ocu05161  Hepatitis B
ocu05163  Human cytomegalovirus infection
ocu05165  Human papillomavirus infection
ocu05166  Human T-cell leukemia virus 1 infection
ocu05203  Viral carcinogenesis
ocu05207  Chemical carcinogenesis - receptor activation
ocu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100358175 (CREB3L4)
   04024 cAMP signaling pathway
    100358175 (CREB3L4)
   04022 cGMP-PKG signaling pathway
    100358175 (CREB3L4)
   04151 PI3K-Akt signaling pathway
    100358175 (CREB3L4)
   04152 AMPK signaling pathway
    100358175 (CREB3L4)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100358175 (CREB3L4)
   04922 Glucagon signaling pathway
    100358175 (CREB3L4)
   04915 Estrogen signaling pathway
    100358175 (CREB3L4)
   04926 Relaxin signaling pathway
    100358175 (CREB3L4)
   04935 Growth hormone synthesis, secretion and action
    100358175 (CREB3L4)
   04918 Thyroid hormone synthesis
    100358175 (CREB3L4)
   04928 Parathyroid hormone synthesis, secretion and action
    100358175 (CREB3L4)
   04916 Melanogenesis
    100358175 (CREB3L4)
   04925 Aldosterone synthesis and secretion
    100358175 (CREB3L4)
   04927 Cortisol synthesis and secretion
    100358175 (CREB3L4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100358175 (CREB3L4)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    100358175 (CREB3L4)
  09156 Nervous system
   04725 Cholinergic synapse
    100358175 (CREB3L4)
   04728 Dopaminergic synapse
    100358175 (CREB3L4)
  09149 Aging
   04211 Longevity regulating pathway
    100358175 (CREB3L4)
  09159 Environmental adaptation
   04714 Thermogenesis
    100358175 (CREB3L4)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    100358175 (CREB3L4)
   05203 Viral carcinogenesis
    100358175 (CREB3L4)
  09162 Cancer: specific types
   05215 Prostate cancer
    100358175 (CREB3L4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100358175 (CREB3L4)
   05161 Hepatitis B
    100358175 (CREB3L4)
   05163 Human cytomegalovirus infection
    100358175 (CREB3L4)
   05165 Human papillomavirus infection
    100358175 (CREB3L4)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100358175 (CREB3L4)
   05020 Prion disease
    100358175 (CREB3L4)
  09165 Substance dependence
   05030 Cocaine addiction
    100358175 (CREB3L4)
   05031 Amphetamine addiction
    100358175 (CREB3L4)
   05034 Alcoholism
    100358175 (CREB3L4)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100358175 (CREB3L4)
   04934 Cushing syndrome
    100358175 (CREB3L4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100358175 (CREB3L4)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100358175 (CREB3L4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4407 KASH_CCD DUF1664 DUF4200 HALZ Jnk-SapK_ap_N HAUS-augmin3 YabA EMP24_GP25L ADIP
Other DBs
NCBI-GeneID: 100358175
NCBI-ProteinID: XP_002715527
Ensembl: ENSOCUG00000011784
UniProt: G1T1Z1
LinkDB
Position
13:complement(38550732..38556387)
AA seq 395 aa
MDLGTPDLLDAWLEPPEDIFSTGSYLELGLQCPPPEAPGTRLQEQGPQGWESGGDHGCGL
QENEPEDCLRIFIDPNEVYCSEASPGSDSGISEDPGGSDSPPAPQAPSSPALYEVVYEAG
ALESMQGEAGPTVGLISIQLDQWSRPLMAPDACMVNKLPLDAQTHILPRAGTVAPVLPET
LLPCQPLFLTDEEKRLLGQEGVSLPSHLPLTKAEERVLKKVRRKIRNKQSAQDSRRRKKE
YIDGLESRVAACSAQNQELQKKVQELERHNISLVAQLRQLQTLIAQTSTKAAQTSTCVVI
LLFSLALIILPSFSPFQGLPEAGPEDYQAHGVISRNILTHKDMTENLDTPVTESRLREPP
GAKSANDSARTLLEKMGGRVGPRGRATAVLHADEM
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggacctcggcacccctgacctgctggacgcctggctggagcccccagaggatattttc
tccacaggctcctacctggagctgggactccagtgtcctcccccagaggccccagggacc
aggctgcaggagcagggcccacaaggctgggagtctggcggggaccatggctgtggcctt
caggagaacgagcctgaagactgcctgaggatcttcatcgatcccaatgaggtgtactgc
tcagaggcctctcctggcagcgacagtggcatttctgaggaccccggcggttcagacagc
ccccctgcccctcaagcacccagttctcctgccctctatgaggttgtctatgaggcaggg
gccctggagagcatgcagggggaagctggacccaccgtagggctcatctccattcagctt
gatcagtggagccgaccattgatggcacctgatgcctgcatggtcaacaagctgcccttg
gatgcccagacccacatcctgccgagagcaggcaccgtagcccccgtgctgcctgagacc
ctgctgccatgtcaaccactgttcctgacagatgaggagaagcggctgctggggcaggaa
ggggtttctttgccctctcacctgcccctcaccaaggcagaggagagggtcctcaagaaa
gtcaggaggaaaatccggaacaagcagtcagctcaggacagccggaggcggaagaaagag
tacatcgatggcctagagagcagggtggcagcctgttctgcacagaaccaggaactacag
aaaaaagttcaggagctagagaggcacaacatctccttggtggctcagctccgccagctg
cagacactcattgctcaaacctccaccaaggctgcccagaccagcacttgtgttgtgata
cttcttttttccctggctctcatcatcctgcccagcttcagcccctttcaaggcctacca
gaagctgggcctgaggattaccaggctcatggagtgatttcccgaaatatcctgacccac
aaggacatgacagaaaatctggacaccccagtgacagagtccaggctgagggagccacct
ggagccaagagtgccaacgactctgcgaggacactgcttgagaagatgggagggagggtg
ggacccagggggcgtgccacagcagtgctgcatgcagatgagatgtga

DBGET integrated database retrieval system