KEGG   Oryctolagus cuniculus (rabbit): 100339386
Entry
100339386         CDS       T03373                                 
Symbol
SOCS1
Name
(RefSeq) suppressor of cytokine signaling 1
  KO
K04694  suppressor of cytokine signaling 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04380  Osteoclast differentiation
ocu04630  JAK-STAT signaling pathway
ocu04910  Insulin signaling pathway
ocu04917  Prolactin signaling pathway
ocu04930  Type II diabetes mellitus
ocu04935  Growth hormone synthesis, secretion and action
ocu05145  Toxoplasmosis
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100339386 (SOCS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100339386 (SOCS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100339386 (SOCS1)
   04917 Prolactin signaling pathway
    100339386 (SOCS1)
   04935 Growth hormone synthesis, secretion and action
    100339386 (SOCS1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100339386 (SOCS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100339386 (SOCS1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100339386 (SOCS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100339386 (SOCS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100339386 (SOCS1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100339386 (SOCS1)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100339386
NCBI-ProteinID: XP_008255942
LinkDB
Position
6:complement(4820896..4821761)
AA seq 199 aa
VSSAADPRRRPEPASSPPSPPAAPARPRPCPAAPAPAPGDTHFRTFRSHADYRRITRTSA
LLDACGFYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQA
GRFHLDGSRETFDCLFELLEHYVAAPRRMLGAPLRQRRVRPLQELCRQRIVATVGRENLA
RIPLNPVLRDYLSSFPFQI
NT seq 600 nt   +upstreamnt  +downstreamnt
gtctcctcggcagcagacccccgacggcggccggagcctgcctcctcccccccctccccg
cccgcggcccctgcgcgcccgcggccgtgcccggcggccccggccccggcccctggcgac
acgcacttccgtacatttcgctcgcacgccgactaccggcgcatcacgcgcaccagcgcg
ctcctcgacgcctgcggcttctactgggggcccctgagcgtgcacggcgcgcacgagcgg
ctgcgcgccgagcccgtgggcaccttcctggtgcgcgacagccgccagcggaactgcttc
ttcgccctcagcgtgaagatggcctcgggccccacgagtatccgcgtgcacttccaggcc
ggccgcttccacctggacggcagccgcgagaccttcgactgcctcttcgagctgctggag
cactacgtggcggcgccgcgccgcatgctgggcgccccgctgcgccagcgccgcgtgcgg
ccgctgcaggagctgtgccgccagcgcatcgtggccaccgtgggccgcgagaacctggcg
cgcatccccctcaaccccgtcctccgcgactacctgagctccttccccttccagatctga

KEGG   Oryctolagus cuniculus (rabbit): 100344911
Entry
100344911         CDS       T03373                                 
Symbol
SOCS6
Name
(RefSeq) suppressor of cytokine signaling 6
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
ocu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100344911 (SOCS6)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100344911 (SOCS6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100344911 (SOCS6)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100344911 (SOCS6)
SSDB
Motif
Pfam: SH2 SOCS_box
Other DBs
NCBI-GeneID: 100344911
NCBI-ProteinID: XP_017199718
Ensembl: ENSOCUG00000001076
LinkDB
Position
9:110442285..110488932
AA seq 535 aa
MKKISLKTFRKSFNLNKSKEESEFMVVQQPSLAGDFGKDDSLFGSCYGKEMASCDINSED
EKGGKSRSKSESLMGTLKRRLSAKQKPKGKGSAPTGGSADEDTFSSSSAPIVFKDVRAQR
PIRSTSLRSHHYSPTPWPLRPTNSEETCIKMEVRVKALVHSSSPSPALNGVRKDFQDLQS
ETVCQEQSNSLKGSDSPNGDLHLHLDEHVPVVIGLMPQDYIQYTVPLDEGMYPLEGSRSY
CLDSSSPMEVSAVPPPGGGSSFPEDENQVDQDLVVAPEIFVDQSVSGLLISTTGVMLQSP
RAGHDDVPPLSPLLPPMQNNQIQRSFSGLAGTDAHVAESVRCHLNFDPNSAPGVARVYDS
VQSSGPMVVTSLTEELKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSL
SFRSHGKTLHTRIEHSNGRFSFYEQPDVEGHTSIVDLIEHSIRDSENGAFCYSRSRLPGS
ATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNKMKDYLQEKHY
NT seq 1608 nt   +upstreamnt  +downstreamnt
atgaagaaaattagtctcaaaacctttcggaagtctttcaacttgaataaaagtaaagaa
gaatctgagttcatggtagtacaacagccgtccctagccggtgactttggaaaagatgat
tccttgtttggtagctgctatggtaaagagatggccagctgtgatatcaacagtgaagac
gaaaaaggtgggaaaagcagatcgaaaagtgaaagcctgatgggcacattaaaaagacgt
ctttctgccaagcagaagcccaaaggcaagggcagcgcgcccacagggggctctgccgac
gaggacaccttctcctcctcctccgcacccatcgtcttcaaggacgtgagagctcagagg
cccatcaggtccacttccctccgcagtcaccactacagccccacgccttggcctcttcgg
cctacaaactctgaggagacgtgcatcaaaatggaggtgagagtcaaagcgctggtccac
tcttccagcccaagtccggcgctgaatggtgttcgaaaggattttcaggaccttcagtct
gaaaccgtgtgccaggagcagagtaactcgctgaagggttcggactctccgaacggggac
ttgcatcttcacctggatgaacatgtgcctgtagttattggacttatgcctcaggactac
attcagtacaccgtgcctttagacgaggggatgtatcctctggaaggatcacgcagctat
tgcctggacagttcttcccccatggaagtctctgcagttcctcctcctgggggagggagc
tcttttcctgaagacgaaaatcaggtagaccaggatctggtggttgccccggagatcttt
gtggatcagtctgtgagtggcttgttgatcagcaccacaggagtcatgttgcagagccca
agagcaggtcatgatgatgtccctccactctcaccattgctacctccaatgcagaataat
caaatccaaaggagcttcagtggactcgctggcacagatgcccatgtggccgagagcgtg
cgctgtcatttgaattttgatcccaactccgctcctggagttgcaagagtttatgactca
gtccagagtagtggtcccatggttgtgacaagccttacagaggaactgaaaaaacttgca
aaacaaggatggtactgggggccaatcacccgctgggaggccgaggggaagctagcaaat
gtgcccgatggttcttttcttgttcgggatagttctgatgaccgttatcttttaagcttg
agctttcgctcccatggtaaaacacttcacactagaattgagcactcaaatggtaggttt
agcttttatgaacaaccagatgtggaaggacatacgtctatagttgatctaattgagcat
tcaatcagggactctgaaaatggagctttttgttattcaaggtctcggttgcctgggtct
gctacttaccctgtcagactgacaaatccagtgtcacggttcatgcaggtgcgttctttg
cagtacctgtgtcgttttgttatacgtcagtataccagaatagacttaattcagaaactg
cctttgcccaacaaaatgaaggattatttgcaggagaagcactactga

KEGG   Oryctolagus cuniculus (rabbit): 100351533
Entry
100351533         CDS       T03373                                 
Symbol
SOCS7
Name
(RefSeq) suppressor of cytokine signaling 7
  KO
K04699  suppressor of cytokine signaling 6/7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
ocu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100351533 (SOCS7)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100351533 (SOCS7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100351533 (SOCS7)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100351533 (SOCS7)
SSDB
Motif
Pfam: SOCS_box SH2
Other DBs
NCBI-GeneID: 100351533
NCBI-ProteinID: XP_017204671
Ensembl: ENSOCUG00000015724
LinkDB
Position
19:39875463..39920628
AA seq 649 aa
MQGAELRDGEAAAAAASYRVLSRLLGYGEAAPEPGPPPPPPPPGHGPPPPPFLTRPGPRG
SRPPQLMVFRNVGRPPEEQDAEAAPEPRPSELLCPRHRCALDPKALPPGLALERTWGPVA
GLEAQLAALGLRQPAAPGVKTVGGGCCPCPCPCPPQAPPPQPQPPAATPQAGEDPTETSD
ALLVLEALESEAESLETNSCSEEELSSPGRGGGGGGGGGTRLLLQPPGPELPPAPFPLQD
LVPPGRLSRGEQQQHPPPPPPPPGPLRPLAGPSRKGSFKIRLSRLFRTKSCTGGSGAGDG
AGKRHSGELAASAASLTDMGGSAGRELDAGRKPRLTRTQSAFSPVSFSPLFTGETVSLVD
VDISQQGLTSPHPPTPPPPPRRSLSLLDDISGTLPTSVLVAPMGSSLQSFPLPPPPPPHA
PDAFPRVAPIRAAESLHSQPPQHLQCPLYRPDSSSFAASLRELEKCGWYWGPMNWEDAEM
KLKGKPDGSFLVRDSSDPRYILSLSFRSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVV
EFIKRAIMHSKNGKFLYFLRSRVPGLPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRI
DHIPDLPLPKPLISYIRKFYYYDPQEEVYLSLKEAQLISKQKQEVEPST
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgcagggggccgagctccgggatggcgaggcggcggcggcggccgcttcctaccgcgtc
ctgagccgcctcctcggttatggagaggcggcccccgagccaggcccgccgccgccgccg
ccgcccccaggccatggccctccgccgccaccctttctcacgcggcccggcccgcggggc
tctcggccgccgcagctgatggtgttccgcaacgtgggtcggccgcctgaggagcaggac
gcggaggcggctccggagccgagaccctcggaactgctgtgcccccggcaccgctgtgcc
ctggaccccaaggccctgccgccgggactggcgctcgagcggacctggggtccggtggct
ggactcgaggcgcagctggcggctctggggctccggcagccggcggcgccgggggtcaag
acagtcggtgggggttgctgcccgtgcccgtgcccgtgccccccgcaggcgccccctcca
cagcctcagccgcctgctgccaccccgcaggccggggaggaccccacggaaacgagcgac
gcactgctggtcctggaggccttggaatcggaggccgagagcctggagactaacagctgc
tcggaagaggagctcagcagcccgggccgcggaggaggaggcggcggcggcggcggcacc
cggctcctgctgcagcccccgggccccgaattgcccccggcgcccttcccgctgcaagac
ttggtccctccggggcgcctgagtagaggggagcagcagcagcaccctcctccgcccccg
ccgccgcctgggcccctccggccgctggcgggcccttctcggaagggctccttcaaaatc
cgcctcagtcgtctctttcgcacgaagagctgcaccggtggctcgggcgctggtgacggg
gccggcaagaggcattctggagagctggctgcttccgccgcgagcctgacggacatggga
ggctctgcgggccgggagctggacgcggggaggaaacccaggttgacaagaactcaaagt
gccttttctccggtctccttcagccccctatttacaggtgaaacagtgtcgcttgtggac
gtggacatttctcagcagggcctgacctctccacaccctccaactccccctcctcctccg
agaagaagcctcagcctcctagatgatatcagtgggacgctgcctacatctgtccttgtg
gctccgatggggtcttccttgcagtctttcccccttcctccgcctcctccaccccatgcc
ccagatgcatttccccgggttgctcccattcgagcagctgaatccctgcacagccagccc
ccccagcacctccagtgtcccctctaccggcctgactcgagcagctttgcagccagtctt
cgagagctagagaagtgtggttggtattgggggccaatgaactgggaagatgccgagatg
aagctgaaaggaaagccagatggttctttcttggtacgagacagttctgaccctcgctac
atcctgagcctcagtttccgatcacagggtatcacccaccacactaggatggagcactac
agaggaaccttcagcctgtggtgtcatcccaagtttgaggatcgctgtcagtccgtggta
gagttcattaaaagagccattatgcactccaagaatgggaagttcctctatttcttgaga
tccagagttccaggactgccaccaactccagtccagctgctctatccagtgtcccgattc
agcaacgtcaaatccctccagcacctttgcagattccggatccgacagcttgtccggata
gatcacatcccggatctcccactgcctaaacctctgatctcttatatccggaagttctac
tactatgatcctcaggaagaggtgtacttgtctctaaaggaagcgcagctcatttccaaa
cagaaacaagaggtggaaccctccacgtag

KEGG   Oryctolagus cuniculus (rabbit): 100353407
Entry
100353407         CDS       T03373                                 
Symbol
SOCS5
Name
(RefSeq) suppressor of cytokine signaling 5
  KO
K04698  suppressor of cytokine signaling 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
ocu04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100353407 (SOCS5)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100353407 (SOCS5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100353407 (SOCS5)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100353407 (SOCS5)
SSDB
Motif
Pfam: SOCS SH2 SOCS_box
Other DBs
NCBI-GeneID: 100353407
NCBI-ProteinID: XP_008252661
Ensembl: ENSOCUG00000015567
LinkDB
Position
2:complement(139492102..139564568)
AA seq 536 aa
MDKVGKMWNNFKYRCQNLFSHEGASRSDHVDMNSNRCLSVKEKGLGAGEPAPQQQSSPLR
ENVALQLGLSPAKGSARRSQNCAAEIPQIVEISIEKENEACAAAGTRLARRDSYSRHAPW
GGKKKHSCSTKTQSSLESDKKVGRTRGGLPRRERRCGLSAGHDADGVSGRALGSRSLRQR
LQDTVGLCFPVRTDHKQPKPLFSNKRKIHLSELMLEKCPFPAGSDLAQKWHLIKQHTAPV
SPHSALFDTFDPSLVSTEDEEDRLRERRRLSIEEGVDPPPNAQIHTFEATAQVNPLYKLG
PKLAPGMTEVSGDGPAAPQASCDPEEDTTTLCLQSRRQKQRQVSGDSHAHVSRQGAWKVH
TQIDYIHCLVPDLLQITGNPCYWGVMDRYEAEALLEGKPEGTFLLRDSAQEDYLFSVSFR
RYNRSLHARIEQWNHNFSFDAHDPCVFHSSTVTGLLEHYKDPSSCMFFEPLLTISLNRTF
PFSLQYICRAVICRCTTYDGIDGLPLPSMLQDFLKEYHYKQKVRVRWLEREPVKAK
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggataaggtggggaagatgtggaataacttcaaataccgctgtcagaatctcttcagc
catgagggagcgagccgcagtgaccatgtggacatgaactccaacaggtgtctgtcggtc
aaagagaagggcctcggcgccggagagcccgctcctcagcaacagagcagccccctacgg
gaaaatgtcgccttacaactgggactgagccccgcaaagggctctgcccggagaagccag
aactgtgcagcggagatcccgcagatagttgaaataagcatcgagaaggagaacgaggcg
tgcgcggccgccgggacgaggcttgcgcgcagagattcctactcgcggcacgccccgtgg
ggagggaagaagaaacattcctgttccaccaagacccagagctcgctggagagcgacaaa
aaggtcgggcggactcggggcgggctcccgaggcgagagcggcgctgcgggctgagcgcg
gggcacgacgccgacggcgtgtccggcagggccttggggagccgctcgctgagacagagg
ctgcaggacaccgtgggcctgtgcttccccgtgagaacggaccacaagcagccaaagccc
ctcttttccaacaaaaggaagatccatctctctgaactcatgcttgaaaagtgccctttc
ccagcgggctccgacctagcgcagaagtggcacctgatcaaacagcacacggcgcctgtg
agcccgcactccgccctctttgataccttcgatccgtctttggtttctacagaagacgag
gaagaccggcttcgagagagacgacgactcagcatcgaagaaggggtggacccccctccc
aatgcccagatccacaccttcgaggctacggcacaggtgaatccgttgtacaaactggga
ccaaagctagctcctgggatgactgaagtgagcggggacggccctgcagcgccgcaggcc
agctgcgacccggaagaggacaccaccaccctgtgcttgcagtctcgcaggcagaagcag
cgtcaggtgtctggggacagccacgcccacgtgagcaggcagggcgcctggaaggtgcac
acccagatcgattacatacactgcctcgtgcccgacctgcttcagattacagggaatccc
tgctactggggcgtgatggaccgctacgaggcagaggcgctgctcgaagggaagccggaa
ggcacgttcttgctcagggactcggcgcaggaggactacctcttctccgtgagcttccgc
cgctacaaccgctccctgcacgcccgcatcgagcagtggaaccacaacttcagtttcgat
gcccacgacccgtgcgtgtttcactcctccactgtaacaggacttctagaacattacaaa
gatcccagctcctgcatgttttttgaaccattgctgacgatctccctcaataggactttc
cctttcagcctgcagtacatctgccgggcggtgatctgcaggtgcaccacgtatgatggc
atcgatgggctccctttaccgtccatgttgcaggattttttaaaagagtatcattataaa
cagaaagttagggtccgctggttagaacgagagccagttaaggcgaagtaa

KEGG   Oryctolagus cuniculus (rabbit): 100354019
Entry
100354019         CDS       T03373                                 
Symbol
SOCS2
Name
(RefSeq) suppressor of cytokine signaling 2
  KO
K04695  suppressor of cytokine signaling 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
ocu04910  Insulin signaling pathway
ocu04917  Prolactin signaling pathway
ocu04930  Type II diabetes mellitus
ocu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100354019 (SOCS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100354019 (SOCS2)
   04917 Prolactin signaling pathway
    100354019 (SOCS2)
   04935 Growth hormone synthesis, secretion and action
    100354019 (SOCS2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100354019 (SOCS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100354019 (SOCS2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100354019 (SOCS2)
SSDB
Motif
Pfam: SOCS_box SH2 SH2_2 Condensation
Other DBs
NCBI-GeneID: 100354019
NCBI-ProteinID: XP_002711247
LinkDB
Position
4:72870946..72876880
AA seq 198 aa
MTLRCLEPSGNGAEGTRSQWGTTGPPEEPSPEAARLAKALRELSQTGWYWGSMTVNEAKE
KLKEAPERTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFD
SVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPPLQHLCRLAINKCTGTIWG
LPLPTRLKDYLEEYKFQV
NT seq 597 nt   +upstreamnt  +downstreamnt
atgaccctgcggtgcctcgagccctccgggaatggcgcggaagggacgcggagccagtgg
gggaccacggggccgccggaggagccgtccccagaggcggcgcgtctggcgaaggctctg
cgcgagctcagccaaacaggatggtactggggcagtatgactgttaatgaagccaaagag
aaattaaaagaggcacccgagagaactttcttgattcgagacagttcgcactcagactac
ctactaaccatatctgttaaaacgtcagctgggcccaccaacctccggatcgaataccaa
gatgggaagttcaggttggactccatcatatgtgtcaagtccaagcttaaacagtttgac
agtgtggtgcatctgatcgactactatgttcagatgtgcaaggataagcggacgggcccg
gaagccccccggaacggcacggttcatctgtatctgaccaaaccgctctacacatcggcg
ccacccctgcaacacctctgtcgactggccattaacaagtgcaccggcaccatctgggga
ctgcctttacccaccagactaaaagattacttggaagaatataaattccaggtataa

KEGG   Oryctolagus cuniculus (rabbit): 100357417
Entry
100357417         CDS       T03373                                 
Symbol
SOCS4
Name
(RefSeq) suppressor of cytokine signaling 4
  KO
K04697  suppressor of cytokine signaling 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04630  JAK-STAT signaling pathway
ocu04910  Insulin signaling pathway
ocu04917  Prolactin signaling pathway
ocu04930  Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100357417 (SOCS4)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100357417 (SOCS4)
   04917 Prolactin signaling pathway
    100357417 (SOCS4)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100357417 (SOCS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100357417 (SOCS4)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ECS complex
    Target recognizing subunit (SOCS box)
     100357417 (SOCS4)
SSDB
Motif
Pfam: SOCS SOCS_box SH2 RhgB_N
Other DBs
NCBI-GeneID: 100357417
NCBI-ProteinID: XP_008267904
Ensembl: ENSOCUG00000004006
UniProt: G1SKV6
LinkDB
Position
17:73698270..73722595
AA seq 441 aa
MAESSESNDKNVDVRPKTSRSRSADRKDGYVWSGKKLSWSKKSENCSDTETVNAVEKTEV
PLRSQERKHSCSSIELDLDHSCGHRFLGRSLKQKLQDAVGQCFPIKNCSSRHSSGLPSKR
KIHISELMLDKCPFPPRSDLAFRWHFIKRHTTPINPKSDEWVSTDLSPSELRDGHLKQRR
NMEEDVNCFSHTDVQPCVITTNNASCTGGPVTDSVVNLVSNNSIEDSDMDSDDEIITLCT
SSRKRNKPKWEIDDEILQLETPPKYHTQIDYVHCLVPDLLQINNNPCYWGVMDKYAAEAL
LEGKPEGTFLLRDSAQEDYLFSVSFRRYSRSLHARIEQWNHNFSFDAHDPCVFHSPDITG
LLEHYKDPSACMFFEPLLSTPLIRTFPFSLQHICRTVICNCTTYDGIDALPIPSPMKLYL
KEYHYKSKVRVLRIDAPEQQC
NT seq 1326 nt   +upstreamnt  +downstreamnt
atggcggaaagtagtgaaagtaacgataaaaatgtagatgtaaggcccaaaacaagtcgg
agtagaagtgctgacagaaaggatggttatgtgtggagtggaaaaaagttatcttggtca
aaaaagagtgagaattgttcagatactgaaacagtgaatgctgttgagaaaacggaagtt
cctctaagaagccaagaaaggaagcacagctgttcatccattgagttggacttggatcac
tcctgtgggcatagatttttaggtcgatccctgaaacagaaactgcaagatgctgtggga
cagtgttttccaataaagaactgtagtagccgacactcttcagggcttccgtctaaaaga
aaaattcatatcagtgaacttatgttagataagtgtcctttcccacctcgatcggattta
gcctttaggtggcattttattaaacgacacactactcctataaatcccaaatcagatgaa
tgggtaagcacagatttgtctccaagtgaactgcgggatggtcacctaaaacaaagaagg
aacatggaagaagatgtgaactgtttctcacacaccgacgttcagccttgtgtcatcact
accaacaatgcgtcatgcacaggtggtcctgtgactgactcagtggtgaacctggtttca
aataatagtatagaagatagtgatatggattctgatgatgaaattataacactttgcaca
agttccagaaaaaggaacaaacccaagtgggaaatagatgatgaaatcctgcagctggaa
acacctcccaagtaccacacgcagatcgactatgtccactgtctcgttccagaccttctt
cagatcaataacaacccgtgctactggggagttatggacaaatacgcagctgaagctcta
ctggaaggaaaaccagagggcacctttttacttcgagactcagcacaggaagattattta
ttctctgttagctttagacgctatagtcgttctcttcatgctagaattgaacagtggaat
cacaactttagctttgatgcccatgatccttgtgtcttccattcacctgatattactggt
ctcctagaacattataaggatcccagtgcctgtatgttttttgaaccacttttatccact
cctttaattcggactttccccttttccctgcagcatatatgcagaacagttatttgtaat
tgtacaacttacgatggcattgatgcccttccaattccttctcccatgaagttgtatctg
aaggaatatcattataaatcaaaagttagagtactcaggattgatgcaccagaacaacaa
tgctag

DBGET integrated database retrieval system