KEGG   Oryctolagus cuniculus (rabbit): 100339597
Entry
100339597         CDS       T03373                                 
Symbol
KIF5A
Name
(RefSeq) kinesin family member 5A
  KO
K10396  kinesin family member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04728  Dopaminergic synapse
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100339597 (KIF5A)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100339597 (KIF5A)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100339597 (KIF5A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100339597 (KIF5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100339597 (KIF5A)
   05012 Parkinson disease
    100339597 (KIF5A)
   05014 Amyotrophic lateral sclerosis
    100339597 (KIF5A)
   05016 Huntington disease
    100339597 (KIF5A)
   05020 Prion disease
    100339597 (KIF5A)
   05022 Pathways of neurodegeneration - multiple diseases
    100339597 (KIF5A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100339597 (KIF5A)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100339597 (KIF5A)
   04147 Exosome [BR:ocu04147]
    100339597 (KIF5A)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Others
    100339597 (KIF5A)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100339597 (KIF5A)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100339597 (KIF5A)
SSDB
Motif
Pfam: Kinesin Microtub_bd ATG16 MCM_OB
Other DBs
NCBI-GeneID: 100339597
NCBI-ProteinID: XP_002720965
Ensembl: ENSOCUG00000011273
UniProt: G1TMW4
LinkDB
Position
Un
AA seq 1032 aa
MAETNNECSIKVLCRFRPLNQAEILRGDKFIPIFQGDDSVVIGGKPYVFDRVFPPNTTQE
QVYHACAMQIVKDVLAGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIARDIFNHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVTKTNLSVHEDKNRVPFVKGCTERFVSSPEEI
LDVIDEGKSNRHVAVTNMNEHSSRSHSIFLINIKQENMETEQKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKSYVPYRDSKMTRILQDSLGGNCRTTM
FICCSPSSYNDAETKSTLMFGQRAKTIKNTASVNLELTAEQWKKKYEKEKEKTKAQKETI
AKLEAELSRWRNGENVPETERLAGEDAALGAELCEETPVNDNSSIVVRIAPEERQKYEEE
IRRLYKQLDDKDDEINQQSQLIEKLKQQMLDQEELLVSTRGDNEKVQRELSHLQSENDAA
KEEVKEVLQALEELAVNYDQKSQEVEEKSQQNQLLVDELSQKVATMLSLESELQRLQEVS
GHQRKRIAEVLNGLMKDLSEFSVIVGNGEIKLPVEISGAIEEEFTVARLYISKIKSEVKS
VVKRCRQLENLQVECHRKMEVTGRELSSCQLLISQHEAKIRSLTEYMQSVELKKRHLEES
YDSLSDELAKLQAQETVHEVALKDKEPDTQDADEVKKALEVQMESHREAHHRQLARLRDE
INEKQKTIDELKDLNQKLQLELEKLQADYEKLKSEEHEKSAKLQELTFLYERHEQSKQDL
KGLEETVARELQTLHNLRKLFVQDVTTRVKKSAEMEPEDSGGIHSQKQKISFLENNLEQL
TKVHKQLVRDNADLRCELPKLEKRLRATAERVKALEGALKEAKEGAMKDKRRYQQEVDRI
KEAVRYKSSGKRGHSAQIAKPVRPGHYPASSPTNPCGTRSPECISYTNSLFQNYQNLYLQ
AAPSSTSDMYFANSCSSSAAASSGGSLAPYQKANMDNGNATDINDNRSDLPCGYEAEEPA
KLFPLHQETAAS
NT seq 3099 nt   +upstreamnt  +downstreamnt
atggcggagaccaacaacgaatgtagcatcaaggtgctctgccgatttcggcccctgaac
caggccgagattctgcggggggacaagttcatccccattttccaaggagacgacagcgtc
gtcattggggggaagccctatgtctttgaccgtgtgttccccccgaacacgactcaggag
caagtttatcatgcgtgtgccatgcagattgtcaaagatgtccttgctggctacaatggc
accatctttgcgtatggacagacttcctcagggaaaacccataccatggaggggaagctg
cacgacccccagctgatgggaatcatccctcgcattgcccgagacatcttcaaccacatc
tactccatggatgagaaccttgagttccacatcaaggtttcttactttgagatttacctg
gacaaaatccgtgaccttctggatgtgaccaagacaaacctgtctgtgcacgaggacaag
aaccgggtgccgtttgtcaagggttgtactgagcgctttgtgtccagcccagaggagatt
ttggatgtgattgatgaggggaagtcgaatcgtcacgtggctgtcaccaacatgaatgag
cacagctctcggagccacagcatcttcctcatcaacatcaagcaggagaacatggagacg
gagcagaagctcagtgggaagctgtatctcgtggacctggctgggagtgagaaggtcagc
aagactggagcagagggggccgtgctggacgaggcaaagaatatcaacaagtccctgtcg
gccctgggcaacgtgatctccgcgctggccgagggcactaaaagctacgttccgtatcgt
gacagcaagatgacgcggattctccaggactccctgggaggaaactgcaggacaacgatg
ttcatctgctgctccccgtccagctacaatgacgcggagaccaagtccaccctgatgttt
gggcagcgggcaaagaccattaagaacactgcctctgtgaatctggagttgactgctgag
cagtggaagaagaaatatgagaaggagaaggagaagaccaaggcccagaaggagacgatt
gcgaagctggaggcggagctgagccggtggcgcaatggagagaatgtgcccgagacggag
cgcctggccggggaggacgccgccctgggagctgagctctgcgaggagacccccgtgaac
gacaactcctccatcgtggtgcgcatcgcacccgaggagcggcagaagtacgaggaggag
atccgccgtctctacaagcagctggatgacaaggacgatgagatcaaccagcagagccag
ctcatagagaagctcaagcagcagatgctggaccaggaagagctgctggtgtccactcga
ggggacaacgagaaggtgcagcgggagctgagccacctgcagtcagagaacgatgccgcc
aaggaggaggtgaaggaagtgttgcaggccctggaggagctggccgtgaactacgaccag
aagtcccaggaggtggaggagaagagccagcagaaccagctgctggtggacgagctgtct
cagaaggtggccacgatgctgtccctggagtctgagttgcagcgactccaggaggtcagt
gggcaccagcgcaaacgaattgccgaggtgctgaatgggctgatgaaggacctgagtgag
ttcagcgtcatcgtgggcaacggggaaatcaagctgccagtggagatcagcggggccatc
gaggaggagttcacggtggcacggctctacatcagcaaaatcaaatcggaggttaagtcc
gtggtgaagcggtgccggcagctggagaacctgcaggtggaatgtcatcgcaagatggag
gtgactgggcgcgagctgtcgtcctgccagctcctcatctcccagcatgaggccaagatc
cgctcgcttacggaatacatgcagagtgtggagctgaagaagcggcacctggaggagtcc
tacgactccctgagtgacgagctggccaagctgcaggcccaggaaactgtgcatgaggtg
gccctgaaggacaaggagccggacacccaggatgcggatgaagtgaagaaggctctggag
gtgcagatggagagtcaccgggaggcccatcaccggcagctggcccggctccgggacgag
atcaatgagaagcaaaagaccattgatgaactcaaagacctgaatcagaagctgcagctg
gagctggagaagctgcaggctgactacgagaagctgaagagcgaagagcacgagaagagc
gccaagctgcaggagctgacatttctgtacgagcgacacgagcagtccaagcaggacctc
aagggtctggaggagacagttgcccgtgaactccagaccctccacaaccttcgcaagctg
ttcgttcaagacgtcacgactcgagtcaagaaaagtgcagaaatggagcccgaggacagt
ggggggattcactcccaaaagcagaagatttcctttcttgagaacaacctggaacagctt
acaaaggttcacaaacagctggtacgtgacaatgcagatctgcgttgtgagcttcctaaa
ttggaaaaacgacttagggctacggctgagagagttaaggccctggagggtgcactgaag
gaggccaaggagggcgccatgaaagacaagcggcgctaccagcaggaggtggaccgcatc
aaggaggccgtgcgctacaagagctccggcaagcggggccactcggcgcagatcgccaaa
cctgtccggccaggccactacccagcatcttcacccaccaacccctgtggcacccggagc
ccggagtgcatcagctacaccaacagcctgttccagaactaccagaacctgtacctgcag
gccgctcccagctccacctcagacatgtacttcgccaactcctgtagcagcagcgcggcc
gcatcttccggtggctccttggctccctatcagaaggccaacatggacaatggaaatgcc
acagacatcaacgacaacagaagtgacctgccatgcggctacgaggctgaggagcccgcc
aagcttttccctctgcaccaagagacggcagccagctaa

KEGG   Oryctolagus cuniculus (rabbit): 100348141
Entry
100348141         CDS       T03373                                 
Symbol
KIF5C
Name
(RefSeq) kinesin family member 5C
  KO
K10396  kinesin family member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04728  Dopaminergic synapse
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100348141 (KIF5C)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100348141 (KIF5C)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100348141 (KIF5C)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100348141 (KIF5C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100348141 (KIF5C)
   05012 Parkinson disease
    100348141 (KIF5C)
   05014 Amyotrophic lateral sclerosis
    100348141 (KIF5C)
   05016 Huntington disease
    100348141 (KIF5C)
   05020 Prion disease
    100348141 (KIF5C)
   05022 Pathways of neurodegeneration - multiple diseases
    100348141 (KIF5C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100348141 (KIF5C)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100348141 (KIF5C)
   04147 Exosome [BR:ocu04147]
    100348141 (KIF5C)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Others
    100348141 (KIF5C)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100348141 (KIF5C)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100348141 (KIF5C)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 100348141
NCBI-ProteinID: XP_017198328
Ensembl: ENSOCUG00000009699
LinkDB
Position
7:87488804..87666922
AA seq 957 aa
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGDETVVIGQGKPYVFDRVLPPNTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVS
KTGAEGAVLDEAKNINKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTI
VICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVNLELTAEEWKKKYEKEKEKNKTLKNVI
QHLEMELNRWRNGEAVPEDEQISAKDQKNLEPCDNTPIIDNITPVVAGISTEEKEKYDEE
ISSLYRQLDDKDDEINQQSQLAEKLKQQMLDQDELLASTRRDYEKIQEELTRLQIENEAA
KDEVKEVLQALEELAVNYDQKSQEVEDKTRANEQLTDELAQKTTTLTTTQRELSQLQELS
NHQKKRATEILNLLLKDLGEIGGIIGTNDVKTLADVNGVIEEEFTMARLYISKMKSEVKS
LVNRSKQLESAQMDSNRKMNASERELAACQLLISQHEAKIKSLTDYMQNMEQKRRQLEES
QDSLSEELAKLRAQEKMHEVSFQDKEKEHLTRLQDAEEMKKALEQQMESHREAHQKQLSR
LRDEIEEKQKIIDEIRDLNQKLQLEQEQLSSDYNKLKIEDQEREMKLEKLLLLNDKREQA
REDLKGLEETVSRELQTLHNLRKLFVQDLTTRVKKSVELDSDDGGGSAAQKQKISFLENN
LEQLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENAMRDRKRYQQE
VDRIKEAVRAKNMARRAHSAQIAKPIRPGHYPASSPTAVHAIRGGGGGSSGSAHYQK
NT seq 2874 nt   +upstreamnt  +downstreamnt
atggcggatccagccgaatgcagcatcaaagtgatgtgccggttccggcccctcaacgag
gcggagatcctccgcggggacaaattcatccccaaattcaaaggcgacgagaccgtggtg
atcgggcaagggaagccatatgtctttgacagggtgctgccgcccaacacaacccaagag
caggtttacaatgcgtgtgcgaagcagattgtcaaagatgtccttgaaggttataatggg
acaatttttgcatatgggcagacttcatcaggaaaaacccataccatggagggaaagctt
catgaccctcagctcatggggatcatccccaggattgcacacgacatctttgaccatatc
tactccatggatgagaacctggagtttcacatcaaggtttcgtattttgagatctacttg
gacaaaataagggacttacttgatgtgtccaagaccaacctggctgttcatgaagataaa
aacagagtcccatatgtaaaggggtgcaccgagaggtttgtgtcaagtcccgaggaggtc
atggacgtgatagacgaaggcaaagcaaaccgacatgtggctgtaacaaacatgaatgaa
cacagctctagaagtcacagtatcttcctgattaatattaaacaagagaatgtggagact
gaaaaaaaactcagtgggaagctttatttggttgatttggctgggagcgaaaaggtcagc
aaaactggtgccgagggagctgttctggatgaagctaaaaatatcaataagtctttgtct
gctcttggaaacgtgatctctgccttggcagaagggacaaaaacacatgtgccataccgg
gacagtaagatgactcgaattctccaggactcactgggtgggaactgtaggaccactatt
gtcatttgctgttctccttctgtcttcaatgaggcggagaccaagtccacgttgatgttt
ggacagagagctaagaccatcaagaacacagtctctgtgaacctggaactgacggcggaa
gaatggaagaagaagtatgagaaagagaaagagaaaaacaagactttgaagaacgtgatc
cagcatctggagatggagctcaacaggtggaggaatggagaagctgtgcctgaggatgaa
cagatcagcgctaaggaccagaagaacctggagccgtgtgataacacccccatcatagac
aatatcactcctgttgttgctggcatctctacagaagagaaggagaagtacgatgaggag
atctccagtctctaccgacaactggatgataaggatgatgaaatcaaccagcagagccag
ctggctgagaagctaaagcagcagatgttggatcaggacgagcttttagcttccacaaga
agagactatgagaagatacaggaggagctgacgcgtctgcagattgaaaacgaggcggcc
aaagacgaggtgaaggaggtgctgcaggccctggaggagctggcggtcaactacgaccag
aagtcccaggaagtggaggacaagaccagggccaatgagcagctgacggacgagctggcc
cagaaaacgactacattaacaactacgcagagagagctgagccagctccaagagcttagc
aaccaccagaaaaagagggccaccgagatcctgaatctgctgctgaaggacctgggggag
attggtgggatcattggcaccaacgatgtgaaaacgttggcagatgtgaatggagtcatt
gaggaggagtttaccatggcccgcctgtacatcagcaagatgaagtctgaggtcaagtcc
ctggtgaaccgcagcaaacagctcgagagcgcccagatggactccaacaggaagatgaac
gccagtgaacgggaactggcagcctgccagctgctcatctcccagcatgaagccaagatt
aaatctctgacagactacatgcagaacatggaacagaagaggaggcagctggaagagtcc
caggactcgctcagcgaagagctagccaagctccgagcccaagaaaagatgcacgaagtc
agcttccaggacaaggagaaggaacacctgacgcggctgcaggacgccgaggaaatgaag
aaggccctggagcagcagatggagagccaccgggaagctcaccagaagcagctgtccaga
ctgcgagacgaaattgaagagaagcagaaaatcattgatgagattcgggacttgaatcag
aaactgcaactggaacaagagcagctcagttctgattataacaagctgaaaatagaagac
caagagagagagatgaagctggaaaagcttttattgctcaatgataaaagggaacaagcc
agagaggacctgaaagggctggaggagacggtgtctcgagaactgcagactctccataac
ctccgcaagctctttgtccaggatctgacgacccgagttaaaaaaagtgtggagctggac
agcgatgatggagggggcagtgctgcccagaagcagaaaatctccttcctggaaaacaac
ctggagcagctcaccaaggtgcacaagcagctggttcgagacaacgcagacctgcgctgt
gagctgcccaagctggagaagcggctgcgcgccacagcggagcgcgtcaaggccctggag
agcgcgctgaaggaggccaaggagaacgccatgcgggaccgcaagcgctaccaacaggag
gtggaccgcatcaaggaggcggtgcgcgccaagaacatggcccggagagcccattcggcc
cagatagccaaacccatccgccctggacactacccggcctcgtctccgacagctgtccat
gccattcgaggaggaggcggcggctcttcaggctccgctcactaccagaaataa

KEGG   Oryctolagus cuniculus (rabbit): 100352693
Entry
100352693         CDS       T03373                                 
Symbol
KIF5B
Name
(RefSeq) kinesin family member 5B
  KO
K10396  kinesin family member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
ocu04728  Dopaminergic synapse
ocu05010  Alzheimer disease
ocu05012  Parkinson disease
ocu05014  Amyotrophic lateral sclerosis
ocu05016  Huntington disease
ocu05020  Prion disease
ocu05022  Pathways of neurodegeneration - multiple diseases
ocu05132  Salmonella infection
ocu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100352693 (KIF5B)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    100352693 (KIF5B)
 09160 Human Diseases
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100352693 (KIF5B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100352693 (KIF5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100352693 (KIF5B)
   05012 Parkinson disease
    100352693 (KIF5B)
   05014 Amyotrophic lateral sclerosis
    100352693 (KIF5B)
   05016 Huntington disease
    100352693 (KIF5B)
   05020 Prion disease
    100352693 (KIF5B)
   05022 Pathways of neurodegeneration - multiple diseases
    100352693 (KIF5B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100352693 (KIF5B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ocu04812]
    100352693 (KIF5B)
   04147 Exosome [BR:ocu04147]
    100352693 (KIF5B)
Membrane trafficking [BR:ocu04131]
 Others
  Actin-binding proteins
   Others
    100352693 (KIF5B)
Cytoskeleton proteins [BR:ocu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     100352693 (KIF5B)
Exosome [BR:ocu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100352693 (KIF5B)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 100352693
NCBI-ProteinID: XP_008266229
Ensembl: ENSOCUG00000017493
LinkDB
Position
16:3519652..3557595
AA seq 963 aa
MADPAECNIKVMCRFRPLNESEVNRGDKYVAKFQGEDTVLIASKPYAFDRVFQSSTSQEQ
VYNDCAKKIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPEGMGIIPRIVQDIFNYIY
SMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLSVHEDKNRVPYVKGCTERFVCSPDEVM
DTIDEGKSNRHVAVTNMNEHSSRSHSIFLINVKQENTQTEQKLSGKLYLVDLAGSEKVSK
TGAEGAVLDEAKNINKSLSALGNVISALAEGSTYVPYRDSKMTRILQDSLGGNCRTTIVI
CCSPSSYNESETKSTLLFGQRAKTIKNTVCVNVELTAEQWKKKYEKEKEKNKTLRNTIQW
LENELNRWRNGETVPVDEQFDKEKANLEAFTVDKDITITNDKPAATIGVTGNFTDAERRK
CEEEIAKLYKQLDDKDEEINQQSQLVEKLKTQMLDQEELLASTRRDQDNMQAELNRLQAE
NDASKEEVKEVLQALEELAVNYDQKSQEVEDKTKEYELLSDELNQKSATLASIDAELQKL
KEMTNHQKKRAAEMMASLLKDLAEIGIAVGNNDVKQPEGTGMIDEEFTVARLYISKMKSE
VKTMVKRCKQLEGTQTESNKKMEENEKELAACQLRISQHEAKIKSLTEYLQNVEQKKRQL
EESVDSLSEELVQLRAQEKVHEMEKEHLNKVQTANEVKQAVEQQIQSHRETHQKQISSLR
DEVEAKEKLITDLQDQNQKMMLEQERLRVEHEKLKATDQEKSKKLHELTVMQDRREQARQ
DLKGLEETVAKELQTLHNLRKLFVQDLATRVKKSAEIDSDDTGGSAAQKQKISFLENNLE
QLTKVHKQLVRDNADLRCELPKLEKRLRATAERVKALESALKEAKENASRDRKRYQQEVD
RIKEAVRSKNMARRGHSAQIAKPIRPGQHPAASPTHPSAIRGGGAFVQNSQPVAVRGGGG
KQV
NT seq 2892 nt   +upstreamnt  +downstreamnt
atggcggacccggccgagtgcaacatcaaagtgatgtgtcgcttcagaccgctcaacgag
tccgaggtgaaccgcggcgacaagtacgtggccaagttccagggagaagacacggtcctg
atcgcgtccaagccttatgcatttgatcgggtgttccagtcaagcacatctcaagagcaa
gtatataacgactgtgcaaagaagattgttaaagatgtacttgagggatacaatggaaca
atatttgcatatggacaaacatcatctgggaagacacacacaatggagggtaaacttcat
gatccagaaggcatgggaattattccaagaatagtgcaagatatttttaattatatttac
tccatggatgaaaatttagaatttcatattaaggtttcatattttgaaatatatttggat
aagataagggacctattagatgtttcaaagaccaacctttcagttcatgaagacaaaaac
cgagtcccctatgtaaaggggtgcacagagcgttttgtatgtagtccagatgaagttatg
gatactatagatgaaggaaaatccaacagacatgtagcagttacaaatatgaatgaacat
agctctaggagtcacagtatatttcttattaacgtgaaacaagagaacacgcaaacagaa
caaaagctgagtggaaaactttatctggttgatttagctggtagtgaaaaggttagtaaa
actggagctgaaggtgctgtgctagatgaagctaagaacatcaacaagtcactttctgct
cttgggaatgtcatctctgctctggctgagggcagcacttatgttccatatcgagatagt
aaaatgacaagaatccttcaagattcattaggtggcaactgtagaaccactattgtaatt
tgctgctctccatcatcatacaatgagtctgaaacaaaatccacactcctgtttggtcaa
agggccaaaacaattaagaacacagtttgcgtcaatgtagagttaactgcagaacagtgg
aaaaagaagtatgaaaaagaaaaagaaaaaaataagaccctgcggaataccattcagtgg
cttgaaaatgaactcaaccggtggcgtaatggagagacagtgcctgtagatgaacagttt
gacaaagagaaagccaacttggaagctttcacagtggataaggacattactattaccaat
gataagccagcagccacaattggtgttactggaaatttcactgatgctgaaagaagaaaa
tgtgaagaagaaattgctaaattatacaaacaacttgatgacaaggatgaagaaattaac
cagcagagccaactggtagagaaactaaagacacagatgttggatcaggaagagcttctg
gcatctaccagaagggatcaagacaacatgcaggcggagctgaatcgccttcaagcagaa
aatgatgcctctaaagaagaagtaaaagaagttttacaggctttggaggaactggctgtc
aattacgatcagaagtctcaggaagttgaagataagaccaaggaatatgaattgcttagt
gatgaactgaatcaaaaatcggcaactttagcaagtatagatgctgagcttcagaaactt
aaggaaatgaccaaccaccagaaaaaacgagcagctgagatgatggcatcgttactaaaa
gatcttgcagaaataggaattgctgtgggaaataacgatgtaaagcagcctgagggaact
ggcatgatagacgaagagttcactgtcgccaggctctacatcagcaagatgaagtcagaa
gtcaagacgatggtgaaacgctgcaaacagctagaaggcacacagaccgagagcaacaaa
aaaatggaagaaaatgaaaaggagctagcagcatgccagcttcgcatctcccaacatgaa
gccaaaatcaagtcattgactgaatacctgcaaaatgtggagcagaagaaaaggcagctc
gaagaatctgtcgactccctcagtgaagaactagttcagcttcgagcacaagagaaagtc
catgaaatggaaaaggagcacttaaataaggttcagactgcaaatgaagtgaagcaagcc
gttgaacaacagatccaaagccacagagaaacccatcaaaaacaaatcagtagtttgaga
gatgaagttgaggcaaaagaaaaacttatcactgaccttcaagaccaaaaccagaaaatg
atgttagagcaggaacgtctcagagtagaacatgagaagttgaaagctacagatcaggaa
aagagcaaaaaactacatgaacttacggtcatgcaagacagacgagaacaagcaagacaa
gacttgaagggtttggaagagacagtggcaaaagaacttcagactttacacaacctgcgt
aagctctttgttcaggacctggcaaccagagttaaaaagagcgccgagatcgactctgat
gacactgggggcagtgctgcgcagaagcaaaaaatctcttttctggagaacaatctggaa
cagctcactaaagtgcacaaacagttggtacgtgataatgcggatcttcgctgcgaactt
cccaagttggagaagcgactgagagctacagccgagagagtgaaagctttggagtcggca
ctgaaagaagcgaaggaaaatgcctctcgggatcggaagcgctatcagcaagaagtggac
cgcatcaaggaagcagtcaggtcgaagaacatggccaggagagggcattcggctcagatc
gctaaacccattcggcccgggcagcatccagcagcttctccaactcatccaagtgcaatt
cgcggaggcggcgcctttgttcagaacagccagcctgtggccgtgcggggcggcggaggc
aagcaggtgtaa

DBGET integrated database retrieval system