KEGG   Oryctolagus cuniculus (rabbit): 100339936
Entry
100339936         CDS       T03373                                 
Symbol
NXT2
Name
(RefSeq) nuclear transport factor 2 like export factor 2
  KO
K14285  NTF2-related export protein 1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  Nucleocytoplasmic transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100339936 (NXT2)
   03015 mRNA surveillance pathway
    100339936 (NXT2)
   03008 Ribosome biogenesis in eukaryotes
    100339936 (NXT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100339936 (NXT2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100339936 (NXT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100339936 (NXT2)
   03009 Ribosome biogenesis [BR:ocu03009]
    100339936 (NXT2)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100339936 (NXT2)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100339936 (NXT2)
SSDB
Motif
Pfam: NTF2
Other DBs
NCBI-GeneID: 100339936
NCBI-ProteinID: XP_002720232
Ensembl: ENSOCUG00000008261
UniProt: G1SUT3
LinkDB
Position
X:57961711..57970871
AA seq 197 aa
MRKFRRDWSQEDYERRQGRSDYRHEEPQTSYSYRGGHRREEVVTPPLDQSASGSSMATSV
DFKTYVDQACRAAEEFVNIYYETMDKRRRALTRLYLDKATLIWNGNVVTGLDSLSNFFEM
LPSSEFQVNMLDCQPVHEQATQSQTTVLVVTSGTVKFDGNKQHFFNQNFLLTAHSTPTST
VWKIASDCFRFQDWASC
NT seq 594 nt   +upstreamnt  +downstreamnt
atgagaaaattcagaagagactggtctcaggaagactatgaaaggcgtcaaggaaggagc
gactatcgtcatgaggagccacaaaccagctactcataccgaggaggccacagacgcgag
gaggtagtaacgccgccactggaccaaagtgcttcgggctcctcgatggccacgtccgtg
gatttcaaaacttatgtggatcaagcctgcagagctgctgaggagtttgtgaacatttac
tacgagacaatggacaaaagaagacgggcacttaccaggctgtacctagacaaggccact
ttaatttggaatggaaatgttgtgaccgggctggattctctgagtaatttttttgagatg
ttgccatccagtgagtttcaagtcaacatgttggattgccagccagttcatgagcaagct
acccagtcccagacaacagttcttgttgtgaccagtggaactgtgaagttcgatggaaac
aagcaacacttcttcaaccaaaacttcctgctgaccgctcattccactcccaccagtaca
gtgtggaaaattgccagtgattgcttccgttttcaagactgggctagttgttaa

KEGG   Oryctolagus cuniculus (rabbit): 100351903
Entry
100351903         CDS       T03373                                 
Symbol
NXT1
Name
(RefSeq) nuclear transport factor 2 like export factor 1
  KO
K14285  NTF2-related export protein 1/2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu03008  Ribosome biogenesis in eukaryotes
ocu03013  Nucleocytoplasmic transport
ocu03015  mRNA surveillance pathway
ocu05014  Amyotrophic lateral sclerosis
ocu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 Nucleocytoplasmic transport
    100351903 (NXT1)
   03015 mRNA surveillance pathway
    100351903 (NXT1)
   03008 Ribosome biogenesis in eukaryotes
    100351903 (NXT1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    100351903 (NXT1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100351903 (NXT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ocu03019]
    100351903 (NXT1)
   03009 Ribosome biogenesis [BR:ocu03009]
    100351903 (NXT1)
Messenger RNA biogenesis [BR:ocu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100351903 (NXT1)
Ribosome biogenesis [BR:ocu03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100351903 (NXT1)
SSDB
Motif
Pfam: NTF2 Glyco_tran_10_N Cofilin_ADF DUF4518
Other DBs
NCBI-GeneID: 100351903
NCBI-ProteinID: XP_002710984
Ensembl: ENSOCUG00000025924
UniProt: G1U3H8
LinkDB
Position
4:complement(13605663..13608815)
AA seq 140 aa
MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGHESLSE
FFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGTVKFEGNKQRDFNQNFILTAQAS
PSNTVWKIASDCFRFQDWAN
NT seq 423 nt   +upstreamnt  +downstreamnt
atggcgtctgtggacttcaagacctacgtggaccaggcatgccgggcggccgaggagttc
gtcaacgtgtactacaccaccatggacaagcggcggcgactgctctcgcgcctgtacatg
ggcaccgccaccctcgtgtggaatggaaacgccgtctcaggacacgagtccctgagcgag
ttttttgagatgctgccttccagtgagttccagatcagcgtggtagactgccagcctgtg
cacgacgaagccacgccgagccagaccacggtgctcgtggtcatctgtgggacggtgaag
ttcgagggcaacaaacagcgggacttcaaccagaacttcatcctcaccgcgcaggcctca
cccagcaacaccgtgtggaagatcgccagtgactgcttccgcttccaggactgggccaac
tag

DBGET integrated database retrieval system