KEGG   Oryctolagus cuniculus (rabbit): 100340267
Entry
100340267         CDS       T03373                                 
Name
(RefSeq) E3 ubiquitin-protein ligase HERC2
  KO
K10595  E3 ubiquitin-protein ligase HERC2 [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100340267
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100340267
   03036 Chromosome and associated proteins [BR:ocu03036]
    100340267
   03400 DNA repair and recombination proteins [BR:ocu03400]
    100340267
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100340267
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100340267
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    100340267
DNA repair and recombination proteins [BR:ocu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Ubiquitin ligases
     100340267
SSDB
Motif
Pfam: RCC1 RCC1_2 HECT Cul7 MIB_HERC2 Cyt-b5 ZZ ANAPC10 SH3_15
Other DBs
NCBI-GeneID: 100340267
NCBI-ProteinID: XP_017203836
Ensembl: ENSOCUG00000006754
LinkDB
Position
17:77849363..78011919
AA seq 4241 aa
MLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKL
QDLDVVKVRCGSQFSIALTKDGQVYSWGKGDNQRLGHGTEEHVRYPKLLEGLQGKKVIDV
AAGSTHCLALTEDSEVHSWGSNDQCQHFDTLRVTKPEPAALPGLDTKHIVGIACGPAQSF
AWSSCSEWSIGLRVPFVVDICSMTFEQLDLLLRQVSEGMDGTADWPPPQEKECMAVATLN
LLRLQLHAAISHQVDPEFLGLGLGSGLLNSLKQTVVTLASSAGVLSTVQSAAQAVLQSGW
SVLLPTAEERARALSALLPCAVSGNEVNISPGRRFMIDLLVGSLMADGGLESALNAAITA
EIQDIEAKKEAQKEKEIDEQEVNASTFHRSRTPLDKDLINTGIYESSGKQCLPLVQLIQQ
LLRNIAAQTVARLKDVARRISSCLDFEQHTRERSASLDLLLRFQRLLISKLYPGENIGQT
SDISSPELMGVGSLLKKYTALLCTHIGDILPVAASIASTSWRHFAEVACIVEGDFTGVLL
PELVVSIVLLLSKNAGLMQEAGAVPLLGGLLEHLDRFNHLAPGKERDDHEELAWPGIMES
FFTAQNCRNNEEVTLIRKADLENHNKDGGFWTVIDGKVYDIKDFQTQSLTGNSILAQFAG
EDPVVALEAALQFEDTRESMHAFCVGQYLEPDQEVVTIPDLGSLSSPLIDTERNLGLLLG
LHASYLAMSTPLSPVEVECAKWLQSSIFSGGLQTSQIHYSYNEEKDEDHCSSPGGTPASK
SRLCSHRRALGDHSQAFLQAIADNNIQDHNVKDFLCQIERYCRQCHLTTPITFPPEHPVE
EVGRLLLCCLLKHEDLGHVALSLVHAGTLGIEQVKHRTLPKSVVDVCRVVYQAKCSLIKT
HQEQGRSYKEVCAPVIERLRFLFNELRPAVCNDLSIMSKFKLLSSLPRWRRIAQKIIRER
RKKRIPKKPESTDDEEKIGNEESDLEEACILPHSPINVDKRPITIKSPKDKWQPLLSTVT
GVHRYKWLKQNVQGLYPQSALLSTIAEFALKEEPVDVEKMRKCLLKQLERAEVRLEGIDT
ILRLSAKNFLLPSVQYAMFCGWQRLIPEGIDIGEPLTDCLKDVDLIPPFNRMLLEVTFGK
LYAWAVQNIRNVLMDASARFKELGIQPVPLQTITNENPSGPSLGTIPQARFLLVMFSMLT
LQHGANNLDLLLNSGTLALTQTALRLIGPSCDNVEDDMNASARGASATVLEETRKEMAPV
QLPVSGPELAAMMKIGTRVMRGVDWKWGDQDGPPPGLGRVIGELGEDGWIRVQWDTGSTN
SYRMGKEGKYDLKLAELPVSAQPSAEDSDTEDDSETEQIEKNIHPTAMMLTSTVNLLQTL
CLSVGVHAEIMQGEATKTLCGLLRMLVESGTTDKTSSPNRLVCREQHRSWCTLGFVRSIA
LTPQVCGALSSPQWITLLMKVMEGHAPFTAASLQRQILAVHLLQAVLPSWDKTERARDMK
CLVEKLFGFLGSLLTTCSSDIPLLRESTLRRRRARPQASLTATHSSTLAEEVVALLRTLH
SLSQWNGLINKYINSQLRSVTHSCTGKSSEAAVLDDFFPDSENPEVGGLMAVLAVIGGID
GRLRLGGQVMHDEFGEGTVTRITPKGKITVQFSDMRMCRVCPLNQLKPLPAVAFSVTNLP
FTEPMLSVWAQLVNLAGSKLEKHKIKKSPKQNFAGQVDLDLLRSQQLKLYILKAGRALLS
HQDKLRQILSQPAVQETGTVPTDDGAAASPDLGDMSPEGPQPPMILLQQLLASATQPSPV
KAIFDKQELEAAALAVCQCLAVESTHPLSPGFEDCSSSEATTPISVQHIRPARVKKRKPS
PVPALPIVVQLMEMGFPRRNIEFALKSLTGASGNASGLPGVEALVGWLLDHSDVQVTELS
DADTVSDEYSDEEVVEDVDDTAYPVSSGAVVTESQTYKKRADFLSNDDYAVYVRENIQVG
MMVRCCRTYEEVCEGDVGKVIKLDRDGLHDLNVQCDWQQKGGTYWVRYIHVELIGYPPPS
SSSHIKIGDKVRVKASVTTPKYKWGSVTHQSVGVVKAFSANGKDIIVDFPQQSHWTGLLS
EMELVPSVHPGVTCDGCQMFPINGSRFKCRNCGDFDFCETCFKTKKHNTRHTFGRINEPG
QSAVFCGRSGKQLKRCHSSQPGMLLDSWSRMVKSLNVSSSVNQASRLIDGSEPCWQSSGS
QGKHWIRLEIFPDVLVHRLKMIVDPADSSYMPSLVVVSGGNSLNNLIELKTININSNDTT
VPLLNDCTEYHRYIEIAIKQCRSSGIDCKIHGLILLGRIRAEEEDLAAVPFLASDNEEEE
DDKASSGSLIRKKAGGLESAATIRTKVFVWGLNDKDQLGGLKGSKIKVPSFSETLSALNV
VQVAGGSKSLFAVTVEGKVYACGEATNGRLGLGISSGTVPIPRQITALSSYVVKKVAVHS
GGRHATALTVDGKVFSWGEGDDGKLGHFSRMNCDKPRLIEALKTKRIRDIACGSSHSAAL
TSSGELYTWGLGEYGRLGHGDNTTQLKPKMVKVLLGHRVIQVACGSRDAQTLALTDEGLV
FSWGDGDFGKLGRGGSEGCNIPQNIERLNGQGVCQIECGAQFSLALTKSGVVWTWGKGDY
FRLGHGSDVHVRKPQVVEGLRGKKIVHVAVGALHCLAVTDSGQVYAWGDNDHGQQGNGTT
TVNRKPTLVQGLEGQKITRVACGSSHSVAWTTVDVATPSVHEPVLFQTARDPLGASYLGV
PSDADSSAASNKISGANNSKPNRPSLAKILLSLDGNLAKQQALSHILTALQIMYARDAVV
GALMPAGMIAPVECPSFSSSAPTSDTPAMTSPVNGEECLLAIDMEDRLSPNPWQEKREVV
SSEDAMTPSAVTPSAPTASSRPFIPVTDDPGAASIIAETMTKTKEDVESQNKASGPEPQS
LDEFTSLLIADDTRVVVDLLKLSVCSRAGDRGRDVLSAVLSGMGTAYPQVADMLLELCVT
ELEDVATDSQSGRLSSQPVVVESSHPYTDDTSTSGTVKIPGAEGLRVEFDRQCSTERRHD
PLTVMDGVNRIVSVRSGREWSDWSSELRIPGDELKWKFISDGSVNGWGWRFTVYPIMPAA
GPKDLLSDRCVLSCPSMDLVTCLLDFRLNLTSNRSIVPRLAASLAACAQLSALAASHRMW
ALQRLRKLLTTEFGQSININRLLGENDGETRALSFSGSALAALVKGLPEALQRQFEYEDP
IVRGGKQLLHSPFFKVLVALACDLELDTLPCCAETHKWAWFRRYCMASRVAVALDKRTPL
PRLFLDEVAKKIRELMADSEHMDVLHESHDVFRREQDEQLVQWMNRRPDDWTLSAGGSGT
IYGWGHNHRGQLGGIEGAKVKVPTPCEALATLRPVQLIGGEQTLFAVTADGKLYATGYGA
GGRLGIGGTESVSTPTLLESIQHVFIKKVAVNSGGKHCLALSSEGEVYSWGEAEDGKLGH
GNRSPCDRPRVIESLRGIEVVDVAAGGAHSACVTAAGDLYTWGKGRYGRLGHSDSEDQLK
PKLVEALQGHRVVDIACGSGDAQTLCLTDDDTVWSWGDGDYGKLGRGGSDGCKVPMKIDS
LTGLGVVKVECGSQFSVALTKSGAVYTWGKGDYHRLGHGSDDHVRRPRQVQGLQGKKVIA
IATGSLHCVCCTEDGEVYTWGDNDEGQLGDGTTNAIQRPRLVAALQGKKVNRVACGSAHT
LAWSTSKPASAGKLPAQVPMEYNHLQEIPIIALRNRLLLLHHISELFCPCIPMFDLEGSL
DETGLGPSVGFDTLRGILISQGKEAAFRKVVQATMVRDRQHGPVVELNRIQVKRSRSKGG
LAGPDGTKSVFGQMCAKMSSFSPDSLLLPHRVWKVKFVGESVDDCGGGYSESIAEICEEL
QNGLTPLLIVTPNGRDESGANRDCYLFNPAARAPVHSSMFRFLGVLLGIAIRTGSPLSLN
LAEPVWKQLAGMSLTIADLSEVDKDFIPGLMYIRDNEATSEEFEAMSLPFTVPSASGQDI
QLSSKYTHITLDNRAEYVRLAINYRLHEFDEQVAAVREGMARVVPVPLLSLFTGYELETM
VCGSPDIPLHLLKSVATYKGIEPSASLIQWFWEVMESFSNTERSLFLRFVWGRTRLPRTI
ADFRGRDFVIQVLDKYNPPDHFLPESYTCFFLLKLPRYSCKQVLEEKLKYAIHFCKSIDT
DDYARIALTGEPAADDSSDDSDNEDVDSFASDSTQDYLTGH
NT seq 12726 nt   +upstreamnt  +downstreamnt
atgctggtagctgggcttaaaggactgaaggtcattgatgtggcgtgtgggagtggggat
gctcagaccctggctgtgactgagaacgggcaagtgtggtcatggggagatggtgactat
ggaaaattgggtagaggtggtagcgatggctgcaaaacaccaaagctgatagaaaagctt
caagatttggatgttgtcaaagtccgctgtggaagtcagttttctattgctttgacgaaa
gatggccaagtttattcttggggaaaaggtgacaatcagagacttggacatggaacagaa
gaacatgttcgttaccccaaactcttggaaggcttacaaggaaagaaggtgattgatgtg
gccgcaggctctacccactgcctggccctgaccgaggacagcgaggtccacagctggggg
agcaatgaccagtgccagcattttgacaccttacgtgtgaccaagccagaacctgctgca
ctgccagggctggacacaaaacacatcgttggaattgcttgtgggcctgcccagagcttt
gcctggtcgtcttgttctgagtggtccattggcctccgtgtcccttttgtggtggacatc
tgctcaatgactttcgagcagctggacctcctgctgcggcaggtgagcgagggaatggat
ggcactgcggactggcccccacctcaggagaaggagtgcatggctgtggcaacgctcaat
cttctacgacttcagttgcatgctgccattagtcaccaggttgacccggaattccttggt
ttaggtctgggcagtggcctcctgaacagcctcaagcagactgtggtaaccctggccagc
agcgcgggcgtgctgagcaccgtgcagtcggctgcccaggccgtgctgcagagcggctgg
tccgtgctgctgcctactgccgaggagcgggcccgcgcgctctcggctctcctgccctgt
gcagtttcaggcaatgaagtaaacataagcccaggtcgtcgattcatgattgatcttctg
gtcggcagcctgatggctgatggagggctagagtcggccttgaatgcagccattactgca
gaaatccaggatattgaagccaaaaaagaagcacagaaggaaaaagaaattgatgaacaa
gaagtgaatgcttcaacgtttcacagaagtaggactccattggataaagacctcattaat
acgggaatctatgaatcttctggtaaacagtgtttgcctctggttcagctcatacaacag
cttcttaggaacattgctgctcagactgtagccagattgaaagatgttgcccgtcggatt
tcatcatgtctggactttgagcagcacactcgtgaaagatctgcttcgctggatttgtta
ctgcgttttcagcgtttacttattagtaaactttatccgggagaaaatattggtcagacc
tcagatatttctagtcctgagctgatgggtgttggttccttgctgaaaaagtacacagcc
cttctgtgtacacacattggagatatactgcctgtggcagctagcatcgcttctaccagc
tggcggcactttgcagaggtggcctgcattgtggaaggggacttcaccggtgttctcctt
ccagaactggttgtttctatagtgcttctactcagtaaaaatgctggtcttatgcaagag
gctggagctgttcccctgctgggtggcttattagaacatctggatcggttcaaccacctg
gccccgggaaaggagcgggatgaccacgaagagctagcctggcctggcatcatggaatca
ttttttacagctcaaaactgtagaaataatgaagaagtgacgctaatacgcaaagctgat
ttggagaatcacaataaagatggaggcttctggactgtgattgatgggaaagtgtatgat
ataaaggacttccagacgcagtcactcacaggaaatagtattcttgctcagtttgcaggg
gaagatccagtggtggccttggaagccgctttgcagtttgaagacacacgggaatcaatg
catgcgttctgtgttggccagtatttggagcctgaccaggaagttgttaccataccagat
ctgggaagtctctcttcacctctgatagacacagagaggaatctgggcctgcttcttgga
ttacacgcttcctatcttgcaatgagcacaccgctgtctcctgttgaggttgaatgtgcc
aagtggcttcagtcgtccatcttctctggaggcttgcagaccagccagatccactatagc
tacaatgaggagaaagatgaggaccattgcagctctcccgggggcacacctgccagcaaa
tcacgactctgctcccacagacgggccctgggtgaccattcccaggcattcctgcaagcc
attgctgacaataacatccaggatcacaatgtgaaggactttctgtgtcaaattgaaaga
tactgtaggcagtgccacttgaccacacccatcacgtttcctcctgagcatcctgtggaa
gaggttggccgcttgctgctgtgttgcctcctgaaacatgaagatttaggacatgtggcg
ctatctttagttcacgcaggtacccttggtattgagcaagtaaagcacagaacattgcct
aaatcagtggtggatgtttgtagagttgtgtatcaagcaaaatgctcactcattaagact
catcaagaacagggacggtcttacaaggaggtctgcgctcctgtcatcgaacgtttgaga
ttcctctttaatgaattgagacctgctgtttgcaatgacctgtctataatgtctaaattt
aaactgttaagttctttgccccggtggaggaggatagctcagaagataattagagaacga
agaaaaaagagaattcctaagaagccagagtctactgatgatgaagaaaaaattggaaat
gaagagagtgatttagaagaagcttgcattttgcctcatagtccgataaatgtggacaaa
agacctattacaattaaatcacccaaggataagtggcagccactcttgagtacagtcaca
ggtgttcacagatacaaatggttgaagcagaatgtccaaggtctgtatcctcagtctgca
ctcctcagtacaattgctgaatttgccctgaaagaagaaccagtggatgtagaaaaaatg
agaaagtgccttttgaaacagttggagagagccgaggttcgcctggaagggatagataca
attttaagactgtcagccaaaaatttcttacttccatctgtgcagtatgctatgttttgt
ggatggcaacgacttattcctgagggaattgatataggggaacctcttacagattgttta
aaggatgttgatttgatcccaccttttaatcggatgctgctggaagtaacttttggcaag
ctatatgcttgggctgttcagaatattcgaaatgttttgatggatgcaagtgccagattt
aaagagcttggtatccagccagttcctctgcaaaccattaccaacgagaacccctcagga
ccaagcctgggcacgatccctcaagctcgctttctcctggtgatgttcagcatgctcacg
ttacagcacggtgcaaacaaccttgacctcctgctcaactccgggacactcgccctcacg
cagacagcactgcggctcattggtccgagttgtgataacgttgaggatgacatgaatgct
tctgcccgaggagcgtctgccacggtccttgaagaaacaaggaaggaaatggctcctgtg
cagctccctgtttcagggccagaactggctgccatgatgaagattggaaccagggtcatg
agaggtgtggattggaaatggggcgatcaggatgggcctcccccaggcctaggccgcgtg
attggtgagctgggagaagatgggtggatcagagtccagtgggacacgggcagcaccaat
tcatacagaatggggaaagaaggaaagtacgacctcaagctggcagagctgccggtctct
gcacagccctcggcagaggactcggacacagaggatgactccgaaacggaacagattgaa
aagaacattcaccccactgcaatgatgcttacaagcaccgtcaacttactgcagactctc
tgcctctctgttggagttcatgctgaaatcatgcagggtgaagccaccaagactttgtgt
ggactgctgcgaatgttagtggaaagtggaacgacggacaagacatcttctccaaacagg
ctggtgtgcagggagcagcaccggagctggtgcacgcttgggttcgtgcggagcattgca
ctcacgccacaagtgtgtggtgccctcagctcaccacagtggatcactctgctcatgaag
gtcatggaagggcatgcacctttcaccgccgcctccctgcagaggcagatcttagccgtg
catttgctgcaagcagtccttccatcgtgggataagactgaaagggcgagggacatgaag
tgccttgtggagaaactgtttggcttcttgggtagtctgctcaccacatgttcgtcggac
atcccattactgagagaatccaccctgaggaggcggagggcccgcccacaggcctccctc
actgccactcacagcagcaccctggcagaagaggtggtggcactgctccgcacactgcac
tccctaagtcagtggaatgggctcatcaacaagtacatcaactcccagctccgctctgtc
acccacagctgcacaggaaagtcgtcagaagcagccgtgttagatgatttcttccctgac
tctgagaaccctgaagtagggggtctcatggctgtcctggctgtgattggagggattgat
ggtcgcctacgcctgggaggccaagtcatgcacgatgaatttggagaaggcactgtaacg
cgcatcacccccaagggcaagatcactgtgcagttctctgacatgcggatgtgtcgtgtt
tgcccattgaatcagctgaaaccactccctgccgtggcgtttagcgtgaccaacctaccc
ttcacggagccaatgctctctgtctgggctcagttagtgaaccttgctggaagcaaattg
gaaaagcacaaaataaagaaatcacctaaacagaactttgcaggccaagtggacctggat
ctgctgcggagccagcagctgaagctgtacatactgaaggcagggcgagcgctgctttcc
caccaagataaactgaggcagatcttgtctcagccagctgttcaggagactggaactgtt
cctacagatgatggagcagccgcatcccctgaccttggggacatgtctcctgaagggcca
cagcccccaatgatcctgttgcagcagttgctggcctccgccacccagccatcgccggtg
aaggccatatttgataaacaggaactggaggctgctgctttggctgtgtgtcaatgtttg
gctgtggagtccactcaccctttgagcccggggtttgaagactgcagctccagtgaggct
acgacgcctatctccgtgcagcacatccgccctgccagagtgaagaagcgcaagccgtca
cctgtgcctgcgctgcccattgtggtgcagctcatggagatgggctttcctcgaaggaac
atagagtttgccctgaagtcgctcaccggtgcttccgggaatgcatctggcttgcctggt
gtggaggccttggttgggtggctgctggaccactcagacgtccaggtgacagaactctcg
gacgcagacacagtatctgatgagtattcagatgaggaggtggtggaagatgtggatgat
acagcctaccctgtgtcctctggtgctgttgtgacggagagccagacttacaaaaaacga
gctgatttcttgagtaatgatgattatgctgtatatgtgagagagaatattcaggtggga
atgatggtcagatgctgtcgaacatatgaagaggtttgcgaaggtgatgtaggcaaagtc
atcaaactggatagagatggattgcatgacctcaatgtacagtgtgattggcagcagaaa
ggaggcacttactgggtgaggtatattcacgtagaacttatagggtatcctccaccaagt
tcttcttcccacatcaagattggtgacaaagtgcgagtcaaggcctccgttacaacacca
aaatataagtggggatctgtaactcatcaaagcgtgggagttgtgaaagctttcagtgcc
aatgggaaagatatcattgtcgactttcctcagcagtctcactggactgggttgttatcc
gaaatggaattggtgcctagtgttcatcctggggttacgtgtgatggttgtcagatgttt
cctatcaatggatccagattcaaatgtagaaactgtggtgactttgacttttgtgaaaca
tgtttcaagacaaaaaaacacaacactcggcatacatttggcagaataaatgaaccagga
cagtctgcagtattttgtggccgttctggaaaacagctgaagcgctgtcacagcagccag
ccaggaatgctgctggacagctggtcccgcatggtgaagagcctgaatgtatcatcctca
gtgaaccaggcttcccgtctgattgatggtagcgagccctgctggcagtcatctgggtca
caaggaaagcattggattcgcttggagatattcccagatgttcttgttcatagactaaag
atgatagtagatcctgctgacagtagctatatgccttccctggttgtagtatcaggtgga
aattccctaaataacctgattgaactgaagacaatcaatattaactcaaatgacaccaca
gtgccccttctgaatgactgcacagagtatcacaggtatatcgaaattgccatcaagcag
tgcaggagctcaggaattgattgtaaaatccatggtctcatcctgctgggacggatccgt
gctgaggaagaagatttggctgcggttcctttcttagcttcagacaacgaggaggaagaa
gatgataaagccagcagtggaagccttattagaaagaaggctggagggctggagtcagca
gctacaataagaaccaaagtgtttgtgtggggactgaatgacaaggaccagctgggtggc
ctgaaaggctctaagatcaaagtaccgtcattctctgagactctgtctgctctgaacgtg
gtgcaggtggctggtggttctaaaagtttatttgcagtgactgtggaggggaaggtctat
gcctgtggagaagccaccaatggccggctggggcttggcatttccagtgggacggtgcct
atcccaaggcagatcacagcccttagcagctatgttgtcaagaaggtggctgttcactca
ggtggccggcacgctacagctttaactgttgatgggaaagtgttttcctggggtgaagga
gatgatggaaaactcggccacttcagcagaatgaactgtgacaagccaaggctgatagag
gccctgaaaaccaagcggatccgggacattgcctgtgggagttcacacagcgcggccctc
acatccagcggagaactgtatacctggggccttggagagtatggccgattgggacatggg
gataatacaacacagctaaagcccaagatggtgaaagtccttctcggtcacagagtaatc
caggtggcctgtggaagcagagatgcacagacgctggctctgaccgatgaaggtttggta
ttttcttggggtgatggtgactttggaaaactgggccggggaggaagtgaaggctgtaac
attccccagaacattgagagactaaatggacaaggcgtgtgccagattgagtgtggagct
cagttctctttggctcttaccaagtcaggagtggtttggacatgggggaaaggggactac
ttcagactgggccatggctctgatgtgcatgtgcggaaaccacaggtggtggaaggactg
agggggaagaagattgtgcacgtggctgttggtgccctgcactgtctggcagtcacggac
tcggggcaggtgtatgcttggggtgataatgaccatggtcagcagggcaacggcacgacc
acagtgaatagaaagcccacactcgtgcaaggcttagaaggccagaagatcacacgggtg
gcgtgtgggtcatcgcatagtgtggcatggacaacggtagatgtggccacgccgtctgtt
catgagcctgtcctcttccagactgcacgagaccctttgggtgcttcctatttgggcgtg
ccttcagatgccgattcttctgctgccagtaataaaataagtggtgcgaataattctaag
ccaaatcgcccttcccttgccaagattcttctgtcactggatggaaatctggccaaacag
caggccttatcacatatccttacagcactgcaaatcatgtatgccagagatgcggtggtt
ggggccctgatgccagctggcatgattgcacccgtggagtgcccctcattctcctcctca
gcacccacctcagatacgcctgccatgaccagtcccgtgaatggagaggaatgcttgctg
gctattgatatggaagacagactgagtccaaacccatggcaagaaaaaagagaggttgtc
tcttctgaggatgcgatgactccctctgcagtgaccccatctgctcccacagcctcctct
cggccatttatccccgtgacggacgacccaggggctgccagcatcattgcagaaacaatg
accaaaaccaaagaggatgttgaaagccaaaataaagcatcaggcccggagcctcagtcc
ttggatgagttcaccagcctgctgattgcagatgatacccgtgtggtggtggacctgctt
aaactgtcagtgtgcagccgcgcaggggacaggggcagggacgtgctctcggcagtgctg
tctggcatgggcactgcctacccacaggtggcagatatgttgttggaactctgtgtcacc
gagttggaggatgtcgccacggactcgcaaagtggacgtctttcctctcagcctgtggtg
gtggagagtagccatccctatactgatgacacttctacgagtggcacagtgaaaattcca
ggagcagaaggactcagggtggagtttgaccggcagtgctccacagagaggcgccatgac
cctctcacagtcatggacggcgtcaacaggatcgtctctgtgcggtcaggccgtgagtgg
tctgactggtccagtgagctccgcatcccgggggatgagttaaagtggaaattcatcagt
gatggttctgtgaatgggtggggctggcgcttcactgtctaccccatcatgccagctgca
ggcccaaaggacctcctttccgatcgctgcgtcctctcctgcccatccatggacttggtg
acatgtctgttggacttccgactcaatctcacctccaacagaagcatcgtcccgcgcctt
gcagcctctctggcggcatgtgcacagttgagtgccttagctgccagtcacagaatgtgg
gcccttcaaagattgaggaagctgcttacaactgaatttgggcagtcgattaacataaat
agactgctaggagaaaatgacggggaaacaagagctttgagtttttcaggcagtgctctt
gctgctttggtgaaaggccttccggaagctttgcaaaggcagtttgaatatgaagaccct
attgtgagagggggcaaacagctgctccacagcccattctttaaggtgctagtagctctt
gcctgtgacctggaactagatactctcccttgctgtgctgagacacacaagtgggcttgg
tttcgacggtactgcatggcctctcgtgttgctgtggccctggacaagagaacaccattg
ccccgtctgtttcttgatgaggtggctaagaaaatccgtgagttaatggcggacagcgaa
cacatggatgttctgcatgagagccatgacgttttcagaagagagcaggatgagcagctc
gtgcagtggatgaacaggcgaccagacgactggaccctttctgctggcggcagtggaacc
atttatggatggggacataatcatagagggcagcttgggggcattgaaggtgcaaaagtc
aaagtccccactccatgtgaagcccttgcaactcttagaccagtgcagttaattggagga
gaacagacactctttgctgtgacagctgatgggaagctgtatgccactggttatggtgca
ggtggccgactaggaattggagggacagagtcggtgtctactccaacgttacttgaatcc
attcagcacgtgtttattaagaaagtagctgtgaactcaggaggaaaacactgccttgcc
ctctcttcagaaggagaagtgtactcttggggtgaagcagaagatgggaagttagggcat
ggaaacagaagtccttgtgaccgtcctcgtgtcattgagtctctgagaggaatcgaagtg
gttgatgttgctgctggtggagcccacagtgcttgtgtcacggcagctggggacctgtac
acgtggggcaaaggccggtatggccgcctggggcacagtgacagtgaggaccaactaaag
cccaagctggtggaagcgttgcagggccaccgtgtggtagacattgcctgtggcagtggc
gacgcccagaccctctgcctcaccgatgatgacaccgtgtggtcctggggggacggcgat
tatggcaagcttggcagagggggcagtgacggctgcaaagtgcccatgaagattgattct
ctcacaggacttggagtggttaaagtggaatgtggatcccagttttcggttgcccttacc
aagtctggagccgtatatacttggggcaaaggtgattatcataggctgggccatggatcc
gatgaccatgttcgaagacctcggcaggtccaagggctgcaagggaagaaagtcattgcc
attgctactggctccctgcattgtgtgtgctgcactgaggatggtgaagtttatacatgg
ggtgataatgatgagggccagctaggagatggaacaacgaacgccatccagaggccacgg
ttggtagctgcccttcagggtaagaaggtcaatcgtgtggcctgcggctcagcacataca
ctcgcctggtccaccagcaagcccgccagtgctggcaagctccctgcacaggtccccatg
gagtacaatcacctgcaagaaatccctataattgcattgaggaaccgactgctgctgctg
caccacatctcagagctcttctgcccatgcatccccatgtttgacctggagggctctctt
gatgaaactggactcgggccttctgttggctttgacacgctacgaggaattctgatatct
cagggaaaggaggcagctttccgaaaagtggtgcaagcaactatggtgcgagatcgtcag
catggccccgtggtggaactgaaccgaatccaggtcaaacgttcaaggagtaaaggtgga
ttagcaggccctgatggcaccaagtctgtctttgggcagatgtgtgctaagatgagctca
ttcagtcccgacagcctcctcctccctcaccgcgtctggaaagtcaagttcgtgggcgaa
tctgtggatgactgtgggggtggctacagcgaatccatagccgagatctgtgaagagctg
cagaatggactcacccccctgctgattgtgacacccaatgggagggacgagtctggagcc
aaccgagactgctacctgttcaacccagctgccagggcgcctgtgcacagcagcatgttc
cgcttcctgggcgtgttactgggcatcgccatccgaacagggagtcctctgagcctcaac
ctcgccgagcctgtgtggaagcagctggctggaatgagcctcaccatcgcagacctcagt
gaggttgataaagactttattcctgggctcatgtacatccgtgacaacgaagccacctct
gaggagtttgaggccatgagcctgcccttcacggtgccaagcgccagtggccaggacatt
cagctgagctccaagtacacacacatcaccctggacaaccgtgcggagtacgtccgactg
gcaataaactatagactccatgaatttgatgagcaggtagctgctgttcgggaggggatg
gcccgagttgtgcccgtccccctgctttctctgttcactggatacgaactggagacaatg
gtttgtggcagccccgacatcccactgcaccttttgaagtcagtggcaacatataaagga
atcgaaccatctgcatccctgatccagtggttctgggaggtgatggagtctttctccaac
acagagcgttccctcttccttcgctttgtgtggggccgaaccaggctgcccaggaccatt
gctgacttccgagggagagactttgtcatccaggtattggataaatacaaccctcctgac
cacttccttcctgagtcctacacttgtttcttcctgctgaagttgcccagatactcctgt
aagcaggtgctggaggagaagctgaagtacgccatccacttttgcaaatccatagacaca
gatgattacgctcgcatagccctcacaggagaaccagctgccgatgacagcagtgatgac
tcagataatgaggatgtggattcatttgcttcagattctacgcaagattatttaacagga
cactaa

DBGET integrated database retrieval system