KEGG   Oryctolagus cuniculus (rabbit): 100340273
Entry
100340273         CDS       T03373                                 
Symbol
NTN1
Name
(RefSeq) netrin 1
  KO
K06843  netrin 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100340273 (NTN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    100340273 (NTN1)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Axon guidance molecules
   100340273 (NTN1)
SSDB
Motif
Pfam: Laminin_N NTR Laminin_EGF
Other DBs
NCBI-GeneID: 100340273
NCBI-ProteinID: XP_008268956
Ensembl: ENSOCUG00000027183
LinkDB
Position
19:complement(10173170..10368240)
AA seq 604 aa
MIRAVWEALAALAAVACLVGAVRGGPGLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAF
GKDVRVSSTCGRPPARYCVVSERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCW
QSENYLQFPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQ
CRKMYNRPHRAPITKQNEQEAVCTDSHTDMRPLSGGLIAFSTLDGRPSAHDFDNSPVLQD
WVTATDIRVAFSRLHTFGDENEDDSELARDSYFYAVSDLQVGGRCKCNGHAARCVRDRDG
GLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLS
GRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACRACDCHPVGAAGKTCNQTT
GQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASK
GKLKINMKKYCKKDYAVQINVLKADKAGDWWKFTVNIISVYKQGASRIRRGEQSLWIRSR
DVACKCPKIKPLKKYLLLGSAEDSPDQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGK
CKKA
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgattcgcgcagtgtgggaggcgctggcggcgctggcggcggtggcgtgcttggtgggc
gcggtgcgcggcgggcccgggcttagcatgttcgcgggccaggcggcgcagccggacccc
tgctcggacgagaacggccacccgcgccgctgcatcccagactttgtcaacgcggccttc
ggcaaggacgtgcgcgtgtccagcacttgtggccggcccccggcgcgctactgcgtggtg
agcgagcgcggcgaggagcggctgcgctcctgtcacctgtgcaacgcgtccgaccccaag
aaggcgcacccgcccgccttcctcaccgacctcaacaacccgcacaacctgacgtgctgg
cagtccgagaactacctgcagttcccgcacaacgtcacgctcacgctgtcgctcggcaag
aagttcgaggtgacctacgtgagcctgcagttctgctcgccgcggcccgagtccatggcc
atctacaagtccatggactatgggcgcacgtgggtgcccttccagttctactccacgcag
tgccgcaagatgtataaccggccgcaccgcgcgcccatcaccaagcagaacgaacaggag
gcagtgtgcaccgactcgcacaccgacatgcggccgctttcgggcggcctcatcgccttc
agcacgctggacgggcggccctcggcgcacgacttcgacaactcgccggtgctgcaggac
tgggtcacggccaccgacatccgcgtcgccttcagccgcctgcacacgttcggcgacgag
aacgaggacgactcggagctggcgcgcgactcgtacttctacgccgtgtccgacctgcag
gtgggcggccgctgcaagtgcaacggccacgcggcccgctgcgtgcgcgaccgcgacggc
ggcctggtgtgcgactgccggcacaacacggccggcccggaatgcgaccgctgcaagccc
ttccactacgaccggccctggcagcgcgccacggcccgggaggccaacgagtgcgtggcc
tgcaactgcaacctgcacgcgcggcgctgccgcttcaacatggagctctacaagctttcg
gggcgcaagagcgggggcgtctgcctgaactgccgccacaacaccgccggccgccattgc
cactactgcaaggagggctactaccgcgacatgggcaagcccatcacccaccggaaggcc
tgcagagcctgtgattgccaccccgtgggagccgccggcaaaacctgcaaccagaccacc
gggcagtgcccctgcaaagacggcgtgacgggcatcacctgcaaccgctgtgccaagggc
taccagcagagccgctcccccatcgccccctgcatcaagatccctgtggccccgcccacc
actgcggccagcagcgtggaggagcctgaagactgcgactcctactgcaaggcctccaaa
gggaagctgaagattaacatgaaaaagtactgcaagaaggactatgccgtccagatcaac
gtcctgaaggcggacaaggcaggggactggtggaagttcacggtgaacatcatctcggta
tacaagcagggcgccagtcgcatccgccgcggtgaacagagcctgtggatccgctcgcgg
gacgtcgcctgcaagtgccctaagatcaagcccctcaagaagtacctgctgctgggcagc
gccgaggactcgcccgaccagagtggcatcgtggccgacaagagcagcctggtgatccag
tggcgggacacgtgggcgcggcggctgcgcaagttccagcagcgcgagaagaagggcaag
tgcaagaaggcctag

DBGET integrated database retrieval system