Oryctolagus cuniculus (rabbit): 100340661 Help Entry 100340661         CDS       T03373                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04081   Hormone signaling ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100340661    04015 Rap1 signaling pathway     100340661    04310 Wnt signaling pathway     100340661    04350 TGF-beta signaling pathway     100340661    04072 Phospholipase D signaling pathway     100340661    04071 Sphingolipid signaling pathway     100340661    04024 cAMP signaling pathway     100340661    04022 cGMP-PKG signaling pathway     100340661    04150 mTOR signaling pathway     100340661   09133 Signaling molecules and interaction    04081 Hormone signaling     100340661  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100340661  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100340661    04660 T cell receptor signaling pathway     100340661    04670 Leukocyte transendothelial migration     100340661    04062 Chemokine signaling pathway     100340661   09152 Endocrine system    04921 Oxytocin signaling pathway     100340661    04928 Parathyroid hormone synthesis, secretion and action     100340661   09154 Digestive system    04972 Pancreatic secretion     100340661   09156 Nervous system    04722 Neurotrophin signaling pathway     100340661   09158 Development and regeneration    04360 Axon guidance     100340661  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100340661    05206 MicroRNAs in cancer     100340661    05205 Proteoglycans in cancer     100340661    05203 Viral carcinogenesis     100340661   09162 Cancer: specific types    05210 Colorectal cancer     100340661   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100340661   09171 Infectious disease: bacterial    05135 Yersinia infection     100340661    05133 Pertussis     100340661    05152 Tuberculosis     100340661    05100 Bacterial invasion of epithelial cells     100340661   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100340661    05418 Fluid shear stress and atherosclerosis     100340661  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100340661   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100340661    04031 GTP-binding proteins [BR:ocu04031]     100340661 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100340661 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100340661   Exosomal proteins of other body fluids (saliva and urine)    100340661   Exosomal proteins of colorectal cancer cells    100340661   Exosomal proteins of bladder cancer cells    100340661 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100340661 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  100340661 NCBI-ProteinID:  XP_002713474 Ensembl:  ENSOCUG00000013323 UniProt:  G1T567 LinkDB All DBs Position 9:99141854..99199058 Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggctgccatccggaagaaactggtgattgtcggtgatggtgcttgtggcaagacgtgc ttgctgatagtcttcagcaaggaccagttcccagaggtgtatgtccccacagtgtttgag aactatgtggcagatatcgaagtggatgggaaacaggtagagctggctttgtgggacaca gctggccaggaagattatgatcgcctgaggcccctctcctacccagacactgatgttatc ctgatgtgtttctccattgacagccctgatagtttagaaaatatcccagaaaaatggacc ccagaagtgaagcatttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat cttcggaatgatgaacacacaaggcgggagctagccaagatgaagcaggagccagtaaaa cctgaagagggcagagatatggcaaacaggattggcgcctttgggtacatggagtgttca gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagcggctctgcaa gccagacgtgggaagaaaaaatccgggtgccttgtcttgtga

Oryctolagus cuniculus (rabbit): 100343368 Help Entry 100343368         CDS       T03373                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04081   Hormone signaling ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100343368    04015 Rap1 signaling pathway     100343368    04310 Wnt signaling pathway     100343368    04350 TGF-beta signaling pathway     100343368    04072 Phospholipase D signaling pathway     100343368    04071 Sphingolipid signaling pathway     100343368    04024 cAMP signaling pathway     100343368    04022 cGMP-PKG signaling pathway     100343368    04150 mTOR signaling pathway     100343368   09133 Signaling molecules and interaction    04081 Hormone signaling     100343368  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100343368  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100343368    04660 T cell receptor signaling pathway     100343368    04670 Leukocyte transendothelial migration     100343368    04062 Chemokine signaling pathway     100343368   09152 Endocrine system    04921 Oxytocin signaling pathway     100343368    04928 Parathyroid hormone synthesis, secretion and action     100343368   09154 Digestive system    04972 Pancreatic secretion     100343368   09156 Nervous system    04722 Neurotrophin signaling pathway     100343368   09158 Development and regeneration    04360 Axon guidance     100343368  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100343368    05206 MicroRNAs in cancer     100343368    05205 Proteoglycans in cancer     100343368    05203 Viral carcinogenesis     100343368   09162 Cancer: specific types    05210 Colorectal cancer     100343368   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100343368   09171 Infectious disease: bacterial    05135 Yersinia infection     100343368    05133 Pertussis     100343368    05152 Tuberculosis     100343368    05100 Bacterial invasion of epithelial cells     100343368   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100343368    05418 Fluid shear stress and atherosclerosis     100343368  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100343368   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100343368    04031 GTP-binding proteins [BR:ocu04031]     100343368 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100343368 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100343368   Exosomal proteins of other body fluids (saliva and urine)    100343368   Exosomal proteins of colorectal cancer cells    100343368   Exosomal proteins of bladder cancer cells    100343368 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100343368 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  100343368 NCBI-ProteinID:  XP_051686714 Ensembl:  ENSOCUG00000023126 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MDALRKKLVVVGAGACGKTSLLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDT AGQEEHDRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPGVPLVLVGNKKD LRNDAGTRQALAAWKQEPVRPEAGRDVASRIGAFGYLECSAKTKEGVREVFEMATRAALH ARRGKKRWGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggacgccctccggaagaagctggtggtggtgggagccggcgcctgcggcaagacgagc ctgctggtggtgttcagccgcgaccacttcccggaggagtacgtgcccacggtgttcgag aactacgtggccgacgtggaggtggacggccggcgggtggagctggcgctgtgggacacg gccggccaggaggagcacgaccgcctgcggccgctgtcctacccggacaccgacgtcgtg ctcctgtgcttcgccatcagcagcccggacagcctggagaacgtgccggccaagtgggcc ccggaggtccggcacttctgccccggcgtgcccctcgtcctggtggggaacaagaaggac ctgcggaacgacgcgggcaccaggcaggcgctggcggcctggaagcaggagcccgtgcgg cctgaggcaggcagggacgtggccagcaggattggcgccttcggctacctggagtgttcg gcgaagaccaaagagggcgtgagggaggtgtttgagatggccacgagggctgctctgcac gccagacgcggcaagaagaggtggggctgcctggtcctgtga

Oryctolagus cuniculus (rabbit): 100343680 Help Entry 100343680         CDS       T03373                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04081   Hormone signaling ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100343680    04015 Rap1 signaling pathway     100343680    04310 Wnt signaling pathway     100343680    04350 TGF-beta signaling pathway     100343680    04072 Phospholipase D signaling pathway     100343680    04071 Sphingolipid signaling pathway     100343680    04024 cAMP signaling pathway     100343680    04022 cGMP-PKG signaling pathway     100343680    04150 mTOR signaling pathway     100343680   09133 Signaling molecules and interaction    04081 Hormone signaling     100343680  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100343680  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100343680    04660 T cell receptor signaling pathway     100343680    04670 Leukocyte transendothelial migration     100343680    04062 Chemokine signaling pathway     100343680   09152 Endocrine system    04921 Oxytocin signaling pathway     100343680    04928 Parathyroid hormone synthesis, secretion and action     100343680   09154 Digestive system    04972 Pancreatic secretion     100343680   09156 Nervous system    04722 Neurotrophin signaling pathway     100343680   09158 Development and regeneration    04360 Axon guidance     100343680  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100343680    05206 MicroRNAs in cancer     100343680    05205 Proteoglycans in cancer     100343680    05203 Viral carcinogenesis     100343680   09162 Cancer: specific types    05210 Colorectal cancer     100343680   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100343680   09171 Infectious disease: bacterial    05135 Yersinia infection     100343680    05133 Pertussis     100343680    05152 Tuberculosis     100343680    05100 Bacterial invasion of epithelial cells     100343680   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100343680    05418 Fluid shear stress and atherosclerosis     100343680  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100343680   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100343680    04031 GTP-binding proteins [BR:ocu04031]     100343680 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100343680 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100343680   Exosomal proteins of other body fluids (saliva and urine)    100343680   Exosomal proteins of colorectal cancer cells    100343680   Exosomal proteins of bladder cancer cells    100343680 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100343680 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  100343680 NCBI-ProteinID:  XP_051687671 Ensembl:  ENSOCUG00000021688 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MAALRKKLVVVGAGACGKTSLLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDT AGQEEHDRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPGVPLVLVGNKKD LRNDAGTRRALAAWKQEPVRPEAGRDVASRIGAFGYLECSAKTKEGVREVFEMATRAALH ARRGKKRWGCLVL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggccgccctccggaagaagctggtggtggtgggagccggcgcctgcggcaagacgagc ctgctggtggtgttcagccgcgaccacttcccggaggagtacgtgcccacggtgttcgag aactacgtggccgacgtggaggtggacggccggcgggtggagctggcgctgtgggacacg gccggccaggaggagcacgaccgcctgcggccgctgtcctacccggacaccgacgtcgtg ctcctgtgcttcgccatcagcagcccggacagcctggagaacgtgccggccaagtgggcc ccggaggtccggcacttctgccccggcgtgcccctcgtcctggtggggaacaagaaggac ctgcggaacgacgcgggcaccaggcgggcgctggcggcctggaagcaggagcccgtgcgg cctgaggcaggcagggacgtggccagcaggattggcgccttcggctacctggagtgttcg gcgaagaccaaagagggcgtgagggaggtgtttgagatggccacgagggctgctctgcac gccagacgcggcaagaagaggtggggctgcctggtcctgtga

Oryctolagus cuniculus (rabbit): 100346856 Help Entry 100346856         CDS       T03373                                  Name (RefSeq) LOW QUALITY PROTEIN: transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04081   Hormone signaling ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100346856    04015 Rap1 signaling pathway     100346856    04310 Wnt signaling pathway     100346856    04350 TGF-beta signaling pathway     100346856    04072 Phospholipase D signaling pathway     100346856    04071 Sphingolipid signaling pathway     100346856    04024 cAMP signaling pathway     100346856    04022 cGMP-PKG signaling pathway     100346856    04150 mTOR signaling pathway     100346856   09133 Signaling molecules and interaction    04081 Hormone signaling     100346856  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100346856  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100346856    04660 T cell receptor signaling pathway     100346856    04670 Leukocyte transendothelial migration     100346856    04062 Chemokine signaling pathway     100346856   09152 Endocrine system    04921 Oxytocin signaling pathway     100346856    04928 Parathyroid hormone synthesis, secretion and action     100346856   09154 Digestive system    04972 Pancreatic secretion     100346856   09156 Nervous system    04722 Neurotrophin signaling pathway     100346856   09158 Development and regeneration    04360 Axon guidance     100346856  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100346856    05206 MicroRNAs in cancer     100346856    05205 Proteoglycans in cancer     100346856    05203 Viral carcinogenesis     100346856   09162 Cancer: specific types    05210 Colorectal cancer     100346856   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100346856   09171 Infectious disease: bacterial    05135 Yersinia infection     100346856    05133 Pertussis     100346856    05152 Tuberculosis     100346856    05100 Bacterial invasion of epithelial cells     100346856   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100346856    05418 Fluid shear stress and atherosclerosis     100346856  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100346856   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100346856    04031 GTP-binding proteins [BR:ocu04031]     100346856 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100346856 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100346856   Exosomal proteins of other body fluids (saliva and urine)    100346856   Exosomal proteins of colorectal cancer cells    100346856   Exosomal proteins of bladder cancer cells    100346856 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100346856 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf YbjN SRPRB Motif Other DBs NCBI-GeneID:  100346856 NCBI-ProteinID:  XP_008251117 Ensembl:  ENSOCUG00000024213 UniProt:  G1TGR0 LinkDB All DBs Position Unknown AA seq 316 aa AA seqDB search MLGPHTASGHYCRCTHRTAPSPCCHHGGYKYEVHTQLPVIPAVVHTAPRRVHTAIPRRPH TALTWRGEGKARRVSRSRSCRAPERLAHVRSLVSLRNAPDWRPGRACGAAPPSAMAALRK KLVVVGAGACGKTSLLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDTAGQEEH DRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPGVPXVLVGNKKDLRNDAG TRRALAAWKQEPVRPEAGRDVASRIGAFGYLECSAKTKEGVREVFEMATRAALHARRGKK SGLPKTANRKSPCYSV NT seq 951 nt NT seq  +upstreamnt  +downstreamnt atgttaggtccacacacagcttccggtcactactgccgttgtacacaccgcaccgcacca tctccatgctgccatcatggtggttataaatacgaggtccacacacagcttccggtcatt cctgccgttgtacacaccgcaccgcgccgtgtccacacggccattccgcgccgtcctcac actgccctcacttggcggggagaagggaaagcgcgccgcgtctcccgctcccggagctgc agggctcccgagcggctcgcgcacgtccgttccctcgtcagcctccgcaacgccccggac tggcgcccgggcagggcctgcggcgcggcgcctccctccgccatggctgccctccggaag aagctggtggtggtgggagccggcgcctgcggcaagacgagcctgctggtggtgttcagc cgcgaccacttcccggaggagtacgtgcccacggtgttcgagaactacgtggccgacgtg gaggtggacggccggcgggtggagctggcgctgtgggacacggccggccaggaggagcac gaccgcctgcggccgctgtcctacccggacaccgacgtcgtgctcctgtgcttcgccatc agcagcccggacagcctggagaacgtgccggccaagtgggccccggaggtccggcacttc tgccccggcgtgcccntcgtcctggtggggaacaagaaggacctgcggaacgacgcgggc accaggcgggcgctggcggcctggaagcaggagcccgtgcggcctgaggcaggcagggac gtggccagcaggattggcgccttcggctacctggagtgttcggcgaagaccaaagagggc gtgagggaggtgtttgagatggccacgagggctgctctgcacgccagacgcggcaagaag agtggtttaccaaagactgcaaaccggaagtcaccttgctacagcgtttag

Oryctolagus cuniculus (rabbit): 100348967 Help Entry 100348967         CDS       T03373                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04081   Hormone signaling ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100348967    04015 Rap1 signaling pathway     100348967    04310 Wnt signaling pathway     100348967    04350 TGF-beta signaling pathway     100348967    04072 Phospholipase D signaling pathway     100348967    04071 Sphingolipid signaling pathway     100348967    04024 cAMP signaling pathway     100348967    04022 cGMP-PKG signaling pathway     100348967    04150 mTOR signaling pathway     100348967   09133 Signaling molecules and interaction    04081 Hormone signaling     100348967  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100348967  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100348967    04660 T cell receptor signaling pathway     100348967    04670 Leukocyte transendothelial migration     100348967    04062 Chemokine signaling pathway     100348967   09152 Endocrine system    04921 Oxytocin signaling pathway     100348967    04928 Parathyroid hormone synthesis, secretion and action     100348967   09154 Digestive system    04972 Pancreatic secretion     100348967   09156 Nervous system    04722 Neurotrophin signaling pathway     100348967   09158 Development and regeneration    04360 Axon guidance     100348967  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100348967    05206 MicroRNAs in cancer     100348967    05205 Proteoglycans in cancer     100348967    05203 Viral carcinogenesis     100348967   09162 Cancer: specific types    05210 Colorectal cancer     100348967   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100348967   09171 Infectious disease: bacterial    05135 Yersinia infection     100348967    05133 Pertussis     100348967    05152 Tuberculosis     100348967    05100 Bacterial invasion of epithelial cells     100348967   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100348967    05418 Fluid shear stress and atherosclerosis     100348967  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100348967   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100348967    04031 GTP-binding proteins [BR:ocu04031]     100348967 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100348967 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100348967   Exosomal proteins of other body fluids (saliva and urine)    100348967   Exosomal proteins of colorectal cancer cells    100348967   Exosomal proteins of bladder cancer cells    100348967 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100348967 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB Motif Other DBs NCBI-GeneID:  100348967 NCBI-ProteinID:  XP_051686107 Ensembl:  ENSOCUG00000026684 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MAALRKKLVVVGAGACGKTSLLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDT AGQEEHDRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPGVPLVLVGNKKD LRNDAGTRRALAAWKQEPVRPEAGRDVASRIGAFGYLECSAKTKEGVREVFEMATRAALH ARRGKKSGLPKTANRKSPCYSV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctgccctccggaagaagctggtggtggtgggagccggcgcctgcggcaagacgagc ctgctggtggtgttcagccgcgaccacttcccggaggagtacgtgcccacggtgttcgag aactacgtggccgacgtggaggtggacggccggcgggtggagctggcgctgtgggacacg gccggccaggaggagcacgaccgcctgcggccgctgtcctacccggacaccgacgtcgtg ctcctgtgcttcgccatcagcagcccggacagcctggagaacgtgccggccaagtgggcc ccggaggtccggcacttctgccccggcgtgcccctcgtcctggtggggaacaagaaggac ctgcggaacgacgcgggcaccaggcgggcgctggcggcctggaagcaggagcccgtgcgg cctgaggcaggcagggacgtggccagcaggattggcgccttcggctacctggagtgttcg gcgaagaccaaagagggcgtgagggaggtgtttgagatggccacgagggctgctctgcac gccagacgcggcaagaagagtggtttaccaaagactgcaaaccggaagtcaccttgctac agcgtttag

Oryctolagus cuniculus (rabbit): 100356250 Help Entry 100356250         CDS       T03373                                  Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04081   Hormone signaling ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100356250    04015 Rap1 signaling pathway     100356250    04310 Wnt signaling pathway     100356250    04350 TGF-beta signaling pathway     100356250    04072 Phospholipase D signaling pathway     100356250    04071 Sphingolipid signaling pathway     100356250    04024 cAMP signaling pathway     100356250    04022 cGMP-PKG signaling pathway     100356250    04150 mTOR signaling pathway     100356250   09133 Signaling molecules and interaction    04081 Hormone signaling     100356250  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100356250  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100356250    04660 T cell receptor signaling pathway     100356250    04670 Leukocyte transendothelial migration     100356250    04062 Chemokine signaling pathway     100356250   09152 Endocrine system    04921 Oxytocin signaling pathway     100356250    04928 Parathyroid hormone synthesis, secretion and action     100356250   09154 Digestive system    04972 Pancreatic secretion     100356250   09156 Nervous system    04722 Neurotrophin signaling pathway     100356250   09158 Development and regeneration    04360 Axon guidance     100356250  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100356250    05206 MicroRNAs in cancer     100356250    05205 Proteoglycans in cancer     100356250    05203 Viral carcinogenesis     100356250   09162 Cancer: specific types    05210 Colorectal cancer     100356250   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100356250   09171 Infectious disease: bacterial    05135 Yersinia infection     100356250    05133 Pertussis     100356250    05152 Tuberculosis     100356250    05100 Bacterial invasion of epithelial cells     100356250   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100356250    05418 Fluid shear stress and atherosclerosis     100356250  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     100356250   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     100356250    04031 GTP-binding proteins [BR:ocu04031]     100356250 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100356250 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100356250   Exosomal proteins of other body fluids (saliva and urine)    100356250   Exosomal proteins of colorectal cancer cells    100356250   Exosomal proteins of bladder cancer cells    100356250 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100356250 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Motif Other DBs NCBI-GeneID:  100356250 NCBI-ProteinID:  XP_008249359 Ensembl:  ENSOCUG00000025438 UniProt:  G1TFK6 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MAALRKKLVVVGAGACGKTSPLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDT AGQEEHDRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPSVPLVLVGNKKD LRNDAGTRRALAAWKQEPVRPEAGRDVASRIGAFGYLECSAKTKEGVREVFEMATRAALH ARRGKKSGLPKTANRKSPCYSV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctgccctccggaagaagctggtggtggtgggagccggcgcctgcggcaagacgagc ccgctggtggtgttcagccgcgaccacttcccggaggagtacgtgcccacggtgttcgag aactacgtggccgacgtggaggtggacggccggcgggtggagctggcgctgtgggacacg gccggccaggaggagcacgaccgcctgcggccgctgtcctacccggacaccgacgtcgtg ctcctgtgcttcgccatcagcagcccggacagcctggagaacgtgccggccaagtgggcc ccggaggtccggcacttctgccccagcgtgcccctcgtcctggtggggaacaagaaggac ctgcggaacgacgcgggcaccaggcgggcgctggcggcctggaagcaggagcccgtgcgg cctgaggcaggcagggacgtggccagcaggattggcgccttcggctacctggagtgttcg gcgaagaccaaagagggcgtgagggaggtgtttgagatggccacgagggctgctctgcac gccagacgcggcaagaagagtggtttaccaaagactgcaaaccggaagtcaccttgctac agtgtttag

Oryctolagus cuniculus (rabbit): 127489660 Help Entry 127489660         CDS       T03373                                  Name (RefSeq) transforming protein RhoA-like   KO K04513   Ras homolog gene family, member A Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04014   Ras signaling pathway ocu04015   Rap1 signaling pathway ocu04022   cGMP-PKG signaling pathway ocu04024   cAMP signaling pathway ocu04062   Chemokine signaling pathway ocu04071   Sphingolipid signaling pathway ocu04072   Phospholipase D signaling pathway ocu04081   Hormone signaling ocu04144   Endocytosis ocu04150   mTOR signaling pathway ocu04270   Vascular smooth muscle contraction ocu04310   Wnt signaling pathway ocu04350   TGF-beta signaling pathway ocu04360   Axon guidance ocu04510   Focal adhesion ocu04520   Adherens junction ocu04530   Tight junction ocu04611   Platelet activation ocu04621   NOD-like receptor signaling pathway ocu04625   C-type lectin receptor signaling pathway ocu04660   T cell receptor signaling pathway ocu04670   Leukocyte transendothelial migration ocu04722   Neurotrophin signaling pathway ocu04810   Regulation of actin cytoskeleton ocu04921   Oxytocin signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04972   Pancreatic secretion ocu05100   Bacterial invasion of epithelial cells ocu05132   Salmonella infection ocu05133   Pertussis ocu05135   Yersinia infection ocu05152   Tuberculosis ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05203   Viral carcinogenesis ocu05205   Proteoglycans in cancer ocu05206   MicroRNAs in cancer ocu05210   Colorectal cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     127489660    04015 Rap1 signaling pathway     127489660    04310 Wnt signaling pathway     127489660    04350 TGF-beta signaling pathway     127489660    04072 Phospholipase D signaling pathway     127489660    04071 Sphingolipid signaling pathway     127489660    04024 cAMP signaling pathway     127489660    04022 cGMP-PKG signaling pathway     127489660    04150 mTOR signaling pathway     127489660   09133 Signaling molecules and interaction    04081 Hormone signaling     127489660  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     127489660  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     127489660    04660 T cell receptor signaling pathway     127489660    04670 Leukocyte transendothelial migration     127489660    04062 Chemokine signaling pathway     127489660   09152 Endocrine system    04921 Oxytocin signaling pathway     127489660    04928 Parathyroid hormone synthesis, secretion and action     127489660   09154 Digestive system    04972 Pancreatic secretion     127489660   09156 Nervous system    04722 Neurotrophin signaling pathway     127489660   09158 Development and regeneration    04360 Axon guidance     127489660  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     127489660    05206 MicroRNAs in cancer     127489660    05205 Proteoglycans in cancer     127489660    05203 Viral carcinogenesis     127489660   09162 Cancer: specific types    05210 Colorectal cancer     127489660   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     127489660   09171 Infectious disease: bacterial    05135 Yersinia infection     127489660    05133 Pertussis     127489660    05152 Tuberculosis     127489660    05100 Bacterial invasion of epithelial cells     127489660   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     127489660    05418 Fluid shear stress and atherosclerosis     127489660  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ocu04131]     127489660   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ocu04147]     127489660    04031 GTP-binding proteins [BR:ocu04031]     127489660 Membrane trafficking [BR:ocu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     127489660 Exosome [BR:ocu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    127489660   Exosomal proteins of other body fluids (saliva and urine)    127489660   Exosomal proteins of colorectal cancer cells    127489660   Exosomal proteins of bladder cancer cells    127489660 GTP-binding proteins [BR:ocu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     127489660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf SRPRB Motif Other DBs NCBI-GeneID:  127489660 NCBI-ProteinID:  XP_051697315 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MAALRKKLVVVGAGACGKTSLLVVFSRDHFPEEYVPTVFENYVADVEVDGRRVELALWDT AGQEEHDRLRPLSYPDTDVVLLCFAISSPDSLENVPAKWAPEVRHFCPSVPLVLVGNKKD LRNDAGTRRALAAWKQEPVRPEAGRDVASRIGAFGYLECSAKTKEGVREVFEMATRAALH ARRGKKSGLPKTANRKSPCYSV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctgccctccggaagaagctggtggtggtgggagccggcgcctgcggcaagacgagc ctgctggtggtgttcagccgcgaccacttcccggaggagtacgtgcccacggtgttcgag aactacgtggccgacgtggaggtggacggccggcgggtggagctggcgctgtgggacacg gccggccaggaggagcacgaccgcctgcggccgctgtcctacccggacaccgacgtcgtg ctcctgtgcttcgccatcagcagcccggacagcctggagaacgtgccggccaagtgggcc ccggaggtccggcacttctgccccagcgtgcccctcgtcctggtggggaacaagaaggac ctgcggaacgacgcgggcaccaggcgggcgctggcggcctggaagcaggagcccgtgcgg cctgaggcaggcagggacgtggccagcaggattggcgccttcggctacctggagtgttcg gcgaagaccaaagagggcgtgagggaggtgtttgagatggccacgagggctgctctgcac gccagacgcggcaagaagagtggtttaccaaagactgcaaaccggaagtcaccttgctac agtgtttag

DBGET integrated database retrieval system