KEGG   Oryctolagus cuniculus (rabbit): 100340737
Entry
100340737         CDS       T03373                                 
Symbol
FBXW11
Name
(RefSeq) F-box and WD repeat domain containing 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04340  Hedgehog signaling pathway
ocu04390  Hippo signaling pathway
ocu04710  Circadian rhythm
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100340737 (FBXW11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100340737 (FBXW11)
   04340 Hedgehog signaling pathway
    100340737 (FBXW11)
   04390 Hippo signaling pathway
    100340737 (FBXW11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100340737 (FBXW11)
   04218 Cellular senescence
    100340737 (FBXW11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100340737 (FBXW11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100340737 (FBXW11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100340737 (FBXW11)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100340737 (FBXW11)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100340737 (FBXW11)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100340737 (FBXW11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like NBCH_WD40 WD40_like F-box Nup160 Frtz DUF1513 WD40_2 DUF4508 DUF6188
Other DBs
NCBI-GeneID: 100340737
NCBI-ProteinID: XP_002710424
Ensembl: ENSOCUG00000007739
UniProt: A0A5F9DDB9
LinkDB
Position
3:complement(53069144..53203773)
AA seq 529 aa
MEPDSVIEDKTIELMNTSVMEDQNEDESPKKNTLWQISNGTSSVIVSRKRPSEGNYQKEK
DLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFITALPEQGLDHIAE
NILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKGLSERRGWDQYLFK
NRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENSKGVYCLQYDDEKI
ISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDSTVRVWDVNTGEVL
NTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLVGHRAAVNVVDFDD
KYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECG
ACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPASTLCLRTLVEHSG
RVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYISR
NT seq 1590 nt   +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaagacaagaccatcgagctcatgaacacttcagttatg
gaagatcaaaatgaagatgagtccccaaagaaaaatactctttggcagattagtaatgga
acatcatctgtgatcgtctccagaaagaggccatcggaaggaaactatcaaaaagaaaaa
gacttgtgtattaaatattttgaccagtggtctgaatcagatcaagtggaatttgtggaa
catctgatttcacgaatgtgtcattaccagcatggacatattaactcgtacctgaagccc
atgttgcagcgggacttcattactgctttaccagagcaaggcttagatcacatagcagaa
aacattctttcctacctggatgccaggtctctgtgtgcagcagagctggtatgcaaagaa
tggcagcgagtgatctcagaaggaatgctttggaagaagctgattgagcgaatggtacgc
actgatcccctgtggaagggactttcagaaagaagagggtgggatcagtacctgtttaag
aacagacccacagatggtcctcccaattcattttataggtcattatacccaaagattatc
caggatatagagactatagaatctaactggcggtgtggacgacacaacttgcaaaggatt
cagtgccgctctgaaaatagtaaaggtgtctactgtttacagtatgatgatgaaaaaatt
atcagtggcctacgagataattccattaagatttgggataaaaccagcctggaatgtttg
aaagtgttaacaggacacacaggctctgtcctttgtctgcagtatgatgaacgtgttatt
gtaaccggttcttcagattctactgtgagagtctgggatgtgaacacaggtgaagttctc
aacacattgatccaccacaatgaggctgtactgcacttacgcttcagcaatggactcatg
gtgacctgttctaaggaccgctccattgccgtgtgggacatggcttctgccaccgacatc
actctacgccgtgtcctggttggccaccgtgctgctgtcaatgtagtagactttgatgat
aaatacatcgtgtctgcctctggtgacaggaccatcaaagtctggagtacgagtacctgt
gaatttgttcgtactcttaatgggcacaagcgaggtattgcctgcctccagtacagggat
cgactggttgtgagtggctcctcagataataccatcaggctatgggatatcgaatgtggt
gcctgcttgagagtcctagagggacatgaagaactggtccggtgcatccgatttgataac
aagaggattgtcagtggggcctatgacgggaaaattaaagtttgggacttgcaagctgct
cttgaccctcgggccccagcaagcaccctgtgtttgcgcacattggtggaacattctgga
cgtgtgtttcggctacagtttgatgaatttcagatcatcagcagctcccatgatgacact
attttgatttgggatttcttaaatgtgcctcccagtgcccagaatgagacccgttctccc
tccagaacatacacatacatctccagataa

KEGG   Oryctolagus cuniculus (rabbit): 100342452
Entry
100342452         CDS       T03373                                 
Symbol
SKP2
Name
(RefSeq) S-phase kinase associated protein 2
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04068  FoxO signaling pathway
ocu04110  Cell cycle
ocu04120  Ubiquitin mediated proteolysis
ocu04150  mTOR signaling pathway
ocu05169  Epstein-Barr virus infection
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100342452 (SKP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100342452 (SKP2)
   04150 mTOR signaling pathway
    100342452 (SKP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100342452 (SKP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100342452 (SKP2)
   05203 Viral carcinogenesis
    100342452 (SKP2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100342452 (SKP2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100342452 (SKP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100342452 (SKP2)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100342452 (SKP2)
SSDB
Motif
Pfam: F-box-like F-box LRR_8
Other DBs
NCBI-GeneID: 100342452
NCBI-ProteinID: XP_002714012
Ensembl: ENSOCUG00000009154
LinkDB
Position
11:57343343..57378205
AA seq 424 aa
MHRKHLQEIPDQSGNVTTSFTWGWDSSKTSELLSGMGVSALEKEEVDSENIPQELLSNVG
HPQSPPRKRLKSKGNEKDFVIIRRPKINRENVPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYCLAFDESLWQTLDLTGKNLHPDVIGRLLSRGVVAFRCPRSFMDRPLVEHFSS
FRVQHMDLSNSVINVSTLHGILSQCSKLQNLSLEGLQLSDLIVNNLAQNSNLMRLNLCGC
SGFSESALKTLLSGCSRLDELNLSWCYDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DVSTLVRRCPNLVHLDLSDSIMLKNDCFPEFHQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLREALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcacaggaaacacctccaggagattccagaccagagtggcaacgtcaccactagtttc
acgtggggatgggattccagcaagacttctgaactgctgtcaggcatgggggtctccgcc
ctggagaaggaggaagtggacagtgaaaacatcccccaggaactgctctccaatgtgggc
cacccacagagccccccgcggaaacgcctgaagagcaaaggcaatgagaaagacttcgtg
atcatccgcagaccgaagatcaatagagaaaatgtcccaggtgtttcgtgggattccctt
cccgatgagctgctcctgggaatcttttcctgtctctgcctccccgagctactgaaagtc
tccggggtttgtaagagatggtactgcctagcgtttgatgagtctctgtggcagacatta
gacctcacaggtaaaaatctgcaccctgatgtgattggccgcttgttgtctcgaggggtg
gttgccttccgctgcccgcgatcatttatggaccgaccattggttgaacatttcagctct
ttccgtgtgcagcacatggacctgtcgaactcagtaataaacgtgtctacccttcacggc
attctgtctcagtgctccaagttgcaaaacctaagcctggaaggcctacagctttcggat
ctcatcgtcaataatcttgcacagaactcaaatttaatgcgactaaacctttgtgggtgt
tctggattctctgaatctgccctgaagactttgctaagcggctgctccagactggatgag
ctgaacctctcctggtgctatgacttcactgagaagcacgtgcaggtggctgtggcgcat
gtctcagagaccatcacccagctgaatcttagtggctaccgaaagaatctccaaaagtca
gatgtctctaccctagttagaagatgccccaatcttgtccacctagacttaagtgacagc
atcatgctaaagaatgactgctttccggaatttcaccagctcaactacctccaacacctc
tcactcagtcgatgctatgatataatacctgaaactttacttgaacttggagaaattccc
acgctaaaaacactacaagttttcggaatcgtgccagacggaaccctccaactgctaagg
gaagcccttcctcatctacagattaattgctcccattttaccaccattgccaggccaact
attggcaacaaaaagaaccaggagatatggggcatcaaatgccgactgacactgcagaaa
cccagttgtctatga

KEGG   Oryctolagus cuniculus (rabbit): 100350519
Entry
100350519         CDS       T03373                                 
Symbol
BTRC
Name
(RefSeq) beta-transducin repeat containing E3 ubiquitin protein ligase
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04114  Oocyte meiosis
ocu04120  Ubiquitin mediated proteolysis
ocu04218  Cellular senescence
ocu04310  Wnt signaling pathway
ocu04340  Hedgehog signaling pathway
ocu04390  Hippo signaling pathway
ocu04710  Circadian rhythm
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100350519 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100350519 (BTRC)
   04340 Hedgehog signaling pathway
    100350519 (BTRC)
   04390 Hippo signaling pathway
    100350519 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100350519 (BTRC)
   04218 Cellular senescence
    100350519 (BTRC)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    100350519 (BTRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100350519 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100350519 (BTRC)
   03036 Chromosome and associated proteins [BR:ocu03036]
    100350519 (BTRC)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100350519 (BTRC)
Chromosome and associated proteins [BR:ocu03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100350519 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 NBCH_WD40 F-box WD40_like Nup160 F-box_5 DUF4508 DUF6188
Other DBs
NCBI-GeneID: 100350519
NCBI-ProteinID: XP_002718711
Ensembl: ENSOCUG00000015353
UniProt: G1T991
LinkDB
Position
18:49387803..49605514
AA seq 605 aa
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDC
NNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIV
PKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDF
ITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWR
GLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKSTLECKRILTGHTGSVLCLQYDERVIITGS
SDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRR
VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVV
SGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPR
APAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTY
TYISR
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggacccggccgaggcggtgctgcaggagaaagcgctcaagtttatgtgctctatgccc
aggtctctgtggctgggctgctccagcctggcggacagcatgccttcgctgcgatgcctg
tataacccagggactggcgcactcacagctttccagaattcctcagagagagaagactgt
aataatggcgaaccccctaggaagataataccagagaagaattcacttagacagacttac
aatagttgtgccagactctgcttaaaccaagaaacagtatgtctagcaagcacggctatg
aagactgaaaattgtgtggccaagacaaaacttgccaatggcacttccagtatgattgtg
cccaagcaacggaaactctcagcaagctatgagaaggaaaaggaactctgtgtcaagtat
tttgagcagtggtcagaatctgatcaagtggagtttgtggaacatctgatatcccaaatg
tgtcattaccagcatgggcacataaactcatatcttaaacctatgttgcagagagatttt
ataactgctttgccagcacggggtttggatcatattgctgagaacattctgtcatacctg
gatgccaaatcgttatgtgctgctgaacttgtgtgcaaggaatggtaccgagtgacgtct
gatggcatgttatggaagaaactcatcgagagaatggtcaggacagattctctgtggaga
ggcctggcagaacgaagagggtggggacagtatttattcaaaaacaaacctcctgatggg
aatgctcctcctaactctttttatagagcactttatcctaaaattatacaagacattgag
acaatagaatctaactggaggtgtggaagacatagcttacagagaattcactgccgaagt
gaaacaagcaaaggagtttactgcttacagtacgatgatcagaaaatagtaagcggcctt
cgagacaacacaatcaagatatgggataaaagcacattggaatgcaagcgaattctcacg
ggccacacgggttctgtcctgtgtctgcagtatgacgagagggtgatcataactggatca
tcggattccacggtcagagtgtgggatgtaaatacaggagaaatgctaaacacattgatt
caccattgtgaagcagttctgcacttgcgtttcaataacggcatgatggtgacctgctcc
aaagatcgttccattgctgtatgggatatggcgtccccaactgacattaccctccggagg
gtgctggttggacaccgagctgctgtcaatgttgtagattttgatgacaagtacatcgtt
tctgcatctggggatagaactataaaggtatggaacacaagtacttgtgaatttgtaagg
accttaaatggacacaaacgaggcattgcctgtttgcagtacagagacaggctggttgtg
agcggctcctctgacaacactatcagattgtgggacatagaatgtggcgcgtgtttgcga
gtgttagaaggccatgaagagttggtgcgttgtattcggtttgataacaagaggatagtc
agcggggcctatgacgggaaaattaaagtgtgggatcttgtggctgctttagatccccgt
gctcctgcaggaacactttgtctgcggacccttgtggagcattctggaagagtcttccga
ctccagtttgatgaattccagattgtcagtagttcacatgatgacaccatcctcatctgg
gactttctaaatgatccagctgcccaagctgaacctccgcgttccccttctcgaacatac
acctacatctccagataa

KEGG   Oryctolagus cuniculus (rabbit): 100356214
Entry
100356214         CDS       T03373                                 
Symbol
FBXW7
Name
(RefSeq) F-box and WD repeat domain containing 7
  KO
K10260  F-box and WD-40 domain protein 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100356214 (FBXW7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100356214 (FBXW7)
   04121 Ubiquitin system [BR:ocu04121]
    100356214 (FBXW7)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    100356214 (FBXW7)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100356214 (FBXW7)
SSDB
Motif
Pfam: WD40 Nup160 ANAPC4_WD40 F-box-like NBCH_WD40 F-box PQQ_2 Ge1_WD40 WD40_like eIF2A CDtoxinA PALB2_WD40 Plasmodium_Vir
Other DBs
NCBI-GeneID: 100356214
NCBI-ProteinID: XP_008265548
Ensembl: ENSOCUG00000008440
LinkDB
Position
15:11917941..12061460
AA seq 766 aa
MQKDIHYFQNSSSFGENLVTCNCKGVMRSATILLLWKNVKTFASCDSLAKVQEVASWLLE
MNQELLSVGSKRRRSGGSLRGNPSSSQADEEQMNRVVEEGPQQQQLRPEEEHTARNGEVV
GAELRPGDQNDSQQGPLEENNNRFISVDEDSSGNPEQEEDEEHAGEQEEEDEEEEEMDQE
SDDFDQSDDSSREDEHTHSNSVTNSSSVVDLPIHQLSSSFYTKTTKMKRKLDHGSEVRSF
SLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMF
QSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDL
LQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHRI
DTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHT
GGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDA
TLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGHT
NRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNADS
TVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLV
TLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgcagaaggacatacattacttccaaaactcttcctcctttggtgagaatttagttaca
tgtaattgcaagggagtcatgcgctcagctacaatcctgttactatggaagaatgtgaaa
acctttgcatcttgtgatagtttggccaaggtccaagaagtagcaagctggcttttggaa
atgaatcaggaactgctctctgtgggcagcaaaagacgacgaagtggaggctctctgaga
ggcaacccttcctcaagccaggcagatgaggagcagatgaaccgcgtggtcgaggagggc
ccgcagcagcagcagctgagaccagaggaggaacacactgcaaggaatggtgaggttgtt
ggagctgaacttagacctggagaccaaaatgattcccagcaaggacccttggaagaaaac
aataatcgatttatttcagtagatgaggactcctcaggaaacccagagcaagaggaggat
gaagaacatgctggtgagcaagaggaggaggatgaagaggaagaggagatggaccaggag
agtgatgactttgatcagtctgatgacagtagccgtgaagatgaacatacacatagtaac
agtgtcacaaattccagtagtgttgtggacctgcccattcaccaactctcctcctcattc
tatacaaagacaacaaaaatgaaaagaaagttggaccatggttctgaggttcgttctttt
tcactgggaaagaaaccatgcaaggtctcagaatatacaagtaccactgggcttgtacca
tgttcagcaacaccaacaacttttggggacctgagagcagccaatggccaagggcaacaa
cggcgccgaattacatctgtccaaccacctacaggcctccaggagtggctgaaaatgttt
cagagctggagtggaccagagaaattgcttgcattagatgaactcattgacagttgtgaa
cctacgcaagtaaagcatatgatgcaagtgatagagccccagtttcagcgggacttcatt
tctttgctccctaaagagctggcactttacgtgctttcattcctggaacccaaagacctg
ctacaggcggctcagacgtgccgctactggagaatcttggctgaggacaaccttctctgg
agagagaaatgcaaagaagagggaattgatgaaccattgcacatcaagagaagaaaagta
ataaaaccaggtttcatacacagtccatggaaaagtgcatacatcagacagcacagaatc
gacaccaactggaggcgaggagagctcaagtctcctaaggtgctgaaaggacacgatgat
cacgtgatcacgtgcttacagttctgcggtaaccgaatagttagtggttctgatgacaac
acgttgaaagtgtggtccgcggtcaccggcaaatgcctgaggacattagtgggacataca
ggtggagtatggtcatcccagatgagagacaacatcatcattagtggatctacagacagg
accctcaaagtatggaacgcagagactggagaatgtatacacaccttatatgggcacact
tccactgtgcgctgtatgcatcttcatgagaaacgagttgtgagcggttctcgggatgcc
actcttagggtgtgggatattgagacaggccagtgtttacatgtcctgatgggccacgtc
gcggcagtccgctgtgtgcagtacgacggcagaagggttgttagtggagcctatgatttc
atggtgaaggtgtgggatccggagactgagacctgtctacacacgctgcaggggcatact
aatagagtctattcattacagtttgatggaatccatgtggtgagtggctctcttgatacg
tcgatccgagtgtgggacgtggagacggggaactgcattcacacgctaacggggcaccag
tcgctcacaagtgggatggagctcaaagacaacatcctcgtctctgggaatgcggattct
acagtgaaaatctgggatatcaagacaggacagtgtttacaaacattgcaaggtcccaac
aagcatcagagtgctgtgacctgtttacagttcaacaagaactttgtaatcaccagctca
gatgacggaactgtgaaactgtgggacttgaaaacgggtgaatttattcgaaacctggtc
acattggagagtggggggagtgggggcgtcgtgtggaggatcagagcctccaacacaaag
ctggtgtgtgcagttgggagtcggaatgggactgaagaaaccaagctgctggtgctggac
ttcgatgtggacatgaagtga

KEGG   Oryctolagus cuniculus (rabbit): 100357072
Entry
100357072         CDS       T03373                                 
Symbol
FBXO4
Name
(RefSeq) F-box protein 4
  KO
K10291  F-box protein 4
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100357072 (FBXO4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100357072 (FBXO4)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     100357072 (FBXO4)
SSDB
Motif
Pfam: F-box-like F-box PRANC Arf
Other DBs
NCBI-GeneID: 100357072
NCBI-ProteinID: XP_002714050
Ensembl: ENSOCUG00000009248
UniProt: G1SWV2
LinkDB
Position
11:62811509..62825147
AA seq 387 aa
MAGSEPRSGASSPPPAASDWGRLEAAILSGWRNFWQSVGKERAARTADREEAEEEASSLS
RLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRFFLLRDLPRWSSVDWKSLPD
LEIVKKPISEVADSACFDYMAVYKMCCPYTRRALKSSRPVYGAVTSFLHSLIIQNEPRFA
MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVSFQLSNQHKFNILILYSTT
RKERDRAREEHTSAVNKMFSVQSEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
HEWQDEYSRIMAMTDPAFGSSGRPMLVLSCISQASIKRMPCFYLAHELHLNLLNHPWMVQ
DTEAESLTGFLNGIEWILEEVESKHAK
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcaggaagcgagccacgcagcggagccagctccccgccgccggccgccagcgactgg
ggccgcctggaggccgccatcctcagcggctggaggaacttctggcagtcggtgggtaag
gagagggcggcgaggacggccgatcgcgaggaggcggaggaggaggccagctccctgagt
aggctgccgatcgacgtacagctttacatattgtcctttctctctcctcatgatctgtgt
cagctgggaagcacaaatcattactggaatgaaactgtacgagatccaattctgtggaga
ttttttctcttgcgagatcttcctaggtggtcttctgttgactggaagtcgcttccagat
ctagaaatcgtaaaaaagcccatctctgaggtcgctgatagtgcatgttttgactacatg
gccgtctataaaatgtgctgtccatatacaagaagagccttgaaatccagccgccctgtg
tatggagctgtcacctcttttttgcactcattgatcattcagaacgagccacggtttgct
atgtttggaccaggtttggaagaactgaatacatctttggtgttgagcttgatgtcttct
gaggaactttgcccgacagctggtttgccacagaggcagattgatggtattggatcagga
gtcagttttcagttgagcaaccaacataaattcaacatcctgatattatattcaactacc
agaaaagagagagacagagccagagaagagcatacaagtgcagttaacaagatgttcagt
gtacagagtgaaggagatgatcagcaaggaagccggtacagtgtgattccacaaattcag
aaggtgtgtgaagttgtggatgggttcatctacgttgcaaatgctgaagctcataaaaga
catgaatggcaagatgaatattctcgtattatggcaatgacagatccagcctttgggtct
tcaggcagacccatgctggttttatcttgtatttctcaagcaagtatcaaaagaatgccc
tgtttttatttggcccatgagttgcatctgaatcttctaaaccacccatggatggtccag
gatacagaggctgaaagtctcactggctttttgaatggcatcgagtggattcttgaagaa
gtggaatctaagcatgcaaaataa

DBGET integrated database retrieval system