KEGG   Oryctolagus cuniculus (rabbit): 100340755
Entry
100340755         CDS       T03373                                 
Symbol
SEMA5A
Name
(RefSeq) semaphorin 5A
  KO
K06841  semaphorin 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100340755 (SEMA5A)
SSDB
Motif
Pfam: TSP_1 Sema TSP1_spondin TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 100340755
NCBI-ProteinID: XP_008260544
Ensembl: ENSOCUG00000004275
LinkDB
Position
11:86468054..86836758
AA seq 1074 aa
MKGACMVAWLLSSLGVWRLAQPEPRDAARCQRAEHPVISYKEIGPWLREFRAKNAVDFSQ
LTFDPGQKELVVGARNYLFRLQLEDLSLIQAVEWECDEATRKACYSKGKSQEECQNYIRV
LLVGGDRLFTCGTNAFTPVCTSRSLSNLTEIHDQISGMARCPYSPQHNSTALLTANGELY
AATAMDFPGRDPAIYRSLGVLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYFFFRENAVEH
DCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYHELQSTFLLPEL
DLIYGIFTTNVNSIAASAVCIFNLSAISQAFNGPFKYQENSRSAWLPYPNPNPNFQCGTV
DQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPAFMEDNSRFSHVAVDVVQGRDTLVHIM
YLATDYGTIKKVRAPLNQSSGSCLLEEIELFPERRQEHIRSLQILHSQSVLFVGLREHVA
KVPLKRCQFYRTRSTCIGAQDPYCGWDVAMKKCTSLEESLSMTQWEQSTSACPTRNLTVD
GHFGAWSSWMPCTHTDGGAVGPCLCRSRACDSPAPQCGGWPCEGPSVEIANCSRNGGWTP
WTSWSPCSTSCGIGFQVRQRSCSNPTPRHGGRVCVGQNREERYCNEHLLCPPHMFWTGWG
PWERCTAQCGGGIQARRRTCENGPDCAGCSVEYQPCNTNACPELKKTTPWTPWTPVNISD
NGGHYEQRFRYTCKARLPDPNLLEVGRQRIEMRYCSSDGTSGCSTDGLSGDFLRAGRYSA
HTVNGAWSAWTSWSQCSRDCSRGIRNRKRVCNNPEPKYGGMPCLGPSLEYQECNILPCPV
DGMWSCWSSWSQCSATCGGGHYMRTRSCTNPAPAYGGDICLGLHTEEALCNTQPCPESWS
EWSDWTMCDASGIQIRARQCILLFPVGSQCSGNATESRPCVFDSNFIPEVSVARSSSVEE
KRCGEFNMFHMIAVGLSSSILGCLLTLLVYTYCQRYQQQSHDATVIHPVSPAPLNTSITN
HINKLDKYDSVEAIKAFNKNNLILEERNKYFNPHLTGKTYSNAYFTDLNNYDEY
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgaagggagcctgcatggtcgcctggctgctctcgagcctgggggtgtggagactcgcc
cagcccgagccccgggacgccgcgcggtgccagagggctgagcacccggtcatctcctac
aaagaaattggcccctggttgcgcgagttcagagcgaagaatgctgtggatttctcgcag
ttaacatttgatccaggacagaaagaacttgttgtaggagcaagaaactacctcttcagg
ttgcaactggaagacctgtctctgatccaggccgtggagtgggagtgtgacgaagctacc
aggaaggcctgttacagcaagggcaagtcgcaggaggaatgtcagaactacatccgggtg
cttttggtgggcggcgaccggttgttcacctgtgggaccaacgctttcacacctgtctgc
accagccgctcgttgagtaacctgacggagatccacgaccagatcagtggcatggcccgc
tgtccctacagcccccagcacaactccacggcgctgctcacggccaacggggagctgtac
gctgccacggccatggacttcccgggacgcgatcccgccatttaccgaagcctgggcgtt
ttgccacctctccgtacggcgcagtacaactccaagtggctcaatgaaccaaacttcgtg
tcgtcctacgacatcgggaatttcacctacttcttcttccgggaaaacgccgtggagcac
gactgtgggaagaccgtgttctccagggcggcccgggtgtgcaagaacgacatcggcggg
cgcttcctgctggaggacacgtggaccacgttcatgaaggcgcgcctgaactgctcccgc
cccggcgaggtgcccttctactaccacgagctccagagcaccttcttgctgccggagctc
gacctcatctacggcatcttcaccaccaacgtgaacagcatcgctgcctcggccgtgtgc
atcttcaacctcagcgccatctcacaggctttcaacgggcccttcaagtaccaggagaac
tcccgctccgcctggctgccttatcccaatcccaaccccaacttccagtgcggcaccgtg
gaccagggcctgtacgtgaacctgaccgagaggaacctgcaggacgctcagaagttcatt
ctcatgcacgaagtggtgcagccggtgaccaccgtgccggccttcatggaggacaacagc
cgcttctcccacgtggccgtcgacgtggtgcagggcagagacacccttgtccacatcatg
tatctggccacagactacggcaccatcaagaaagtgcgggcgccgctcaatcagagttcg
ggcagctgcttgctggaggagatcgagctgttcccggagaggcggcaggagcacattcgg
agcctgcagatcctgcacagccagagcgtgctgttcgtgggcctgcgcgagcacgtggcc
aaggtgcccctgaagcggtgccagttctaccgcacgcgcagcacctgcataggggcccag
gatccttactgcggctgggacgtggcgatgaagaaatgcacaagtctcgaggagagcctg
agcatgacgcagtgggagcagagcacctcggcctgcccgaccaggaacctcaccgtggat
ggacactttggcgcgtggtcctcgtggatgccctgcacacacacggacggcggtgctgtc
ggaccctgcctgtgtcggtcccgtgcctgcgacagcccggccccgcagtgtggcggctgg
ccctgcgagggccccagcgtggaaatcgccaactgctccaggaatggcggctggaccccc
tggacctcgtggtcgccctgcagcaccagctgtgggattggcttccaggtgcggcagcgg
tcctgcagcaaccccactccccggcacgggggccgcgtgtgcgtgggacagaaccgcgag
gaaagatactgcaacgagcatctgctgtgccccccccacatgttctggacgggctggggt
ccttgggaacggtgcacagcccagtgcgggggcggcatacaagcacgtcgcaggacctgc
gagaacgggcccgactgcgcaggctgcagcgtggagtaccagccttgtaacaccaacgca
tgccccgagctgaagaagaccaccccctggaccccctggacccctgtcaacatctctgat
aatggcggccactacgagcagcgcttccggtacacgtgcaaagcccgcctgcccgacccc
aacttgctggaagtggggagacagaggattgaaatgcgatactgctccagtgatgggacc
agcggctgctccacagacgggctctctggcgatttcctgcgtgctgggaggtactctgcc
cacactgtcaacggcgcgtggtcagcctggacgtcgtggtcacagtgcagccgggactgc
agcaggggcattcggaaccggaagcgtgtgtgcaacaaccctgagcccaagtatgggggg
atgccttgcctaggcccatccctggaataccaggagtgcaacattttgccctgtccagtg
gacggcatgtggtcctgctggtcctcctggtcacagtgctcagcaacgtgcggcggcgga
cactacatgaggacccggtcgtgcacaaacccagcccctgcctacggaggagacatctgc
ctggggctgcacaccgaagaggccctctgcaacacacagccctgcccagagagctggtcc
gagtggtcagactggaccatgtgcgatgcgtccggaatccagatccgcgcccgccagtgc
atcctcctattccccgtgggcagccagtgttcgggaaatgctactgagagccggccatgc
gtttttgactccaatttcatcccagaagtatctgtggctagatccagcagcgtagaagag
aaaagatgtggagagttcaacatgttccacatgatcgccgtggggctgagcagctccatc
ctcggctgcctcctcaccctgctcgtctacacctactgccagcgctaccagcagcagtcc
cacgacgccaccgtcatccacccagtctcccctgcccctctcaacaccagcatcaccaac
cacatcaacaaactggacaagtatgactcggtggaagccatcaaggcattcaacaaaaac
aacttgatcctagaggaaagaaacaagtacttcaacccccatctcactgggaagacctac
tctaatgcctactttacagatctcaacaattatgatgagtactaa

KEGG   Oryctolagus cuniculus (rabbit): 100354300
Entry
100354300         CDS       T03373                                 
Symbol
SEMA5B
Name
(RefSeq) semaphorin 5B
  KO
K06841  semaphorin 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    100354300 (SEMA5B)
SSDB
Motif
Pfam: TSP_1 Sema TSP1_spondin PSI TSP1_ADAMTS TSP1_CCN
Other DBs
NCBI-GeneID: 100354300
NCBI-ProteinID: XP_008265058
Ensembl: ENSOCUG00000006139
LinkDB
Position
14:96165954..96203686
AA seq 1084 aa
MVAPRPLAVSLLLPSLTLLVSHPSRSQDVSGEPSSEQQLCALREHPTVAFEDLKPWVSNF
TYPGARDFSQLALDPSRNQLIVGARNYLFRLSLANVSLLQATEWASNEDTRRSCQSKGKT
EEECQNYVRVLLVTGRKVFLCGTNAFSPLCTSRQVGNLSRTLEKINGVARCPYDPRHNST
AVISSQGELYAATVIDFSGRDPAIYRSLGSGPPLRTAQYNSKWLNEPNFVAAYDIGLFAY
FFLRENAVEHDCGRTVYSRVARVCKNDVGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNE
LQSAFHLPEQDLIYGVFTTNVNSIAASAVCAFNLSAISQAFNGPFRYQENPRAAWLPIAN
PLPNFQCGTLPETGPNENLTERSLQDAQRLFLMSEAVQAVTPEPCVTQDSLPQGPDTLYH
VLYIGTESGTILKALSTASRSLRGCYLEELHVLPPGRREPLRSLRILHSARALFVGLSEG
VLRVPLERCAAYRSQGACLGARDPYCGWDGKQQRCSTLEDSSNMSLWTQNITACPVRNVT
RDGGFGPWSPWQPCEHLDGDNSGSCLCRARSCDSPQPRCGGLGCLGPAIHIANCSRNGAW
TPWSSWAQCSTSCGIGFQVRQRSCSNPAPRHGGRICVGKSREERFCNEHTPCPVPIFWAS
WGSWSKCSSDCGGGVQSRRRACENGDSCPGCGVEFKTCNPDGCPEVRRNTPWTPWLPVNV
TPGGARQEQRFRFTCRAPLPDPHGLQLGRRRTETRTCPADGSGACDTDALVEDLLRSGNV
GPHALSGGWAPWGPWSSCSRDCELGFRVRKRTCTNPEPRAGGLPCVGDAAEYQDCNPQAC
PVRGAWSCWTSWSPCSASCGGGHYQRTRSCTSPAPSPGEDVCLGLHTEEALCATQACPEG
WSPWSEWGACAEDGAQSRSRHCEELAPGPGTCAGNSSQSRPCPYGEIPVILPASSMEEAT
SCAGFSLIHLVVTGVSCFLGSGLLTLAVYLSCQHCQRQSQESTLVHPATPNHLHYKGGGT
PKNEKYTPMEFKTLNKNNLIPDDRANFYPLQQTNVYTTTYYPSPLNKHSFRPEASPGQRC
FPNS
NT seq 3255 nt   +upstreamnt  +downstreamnt
atggtggcccccagacccctggccgtgtcgctgttgctgcccagcctcaccctgctggtg
tctcatccctcccgctcccaggacgtctccggtgagcccagcagtgagcagcagctctgc
gccctgagggagcaccccaccgtggcctttgaagatctgaagccatgggtctctaacttc
acctaccccggtgcccgagatttctcccagctcgctctggacccctccaggaaccagctc
atcgtgggagccaggaactacctcttcagactcagccttgccaatgtctccctccttcag
gccacggagtgggcctccaacgaggacacacgccgctcctgccaaagcaaaggcaagacc
gaggaggaatgtcagaactacgtgcgagtcctgcttgtcaccggccggaaggtgtttctg
tgcgggaccaatgccttctccccgctctgcaccagcagacaggtggggaacctcagccgg
accctggagaagatcaacggggtggcccgctgcccctatgacccacggcacaactccaca
gccgtcatctcctcccagggcgagctctacgccgccacggtcattgacttctccggtcgg
gaccctgccatctaccgcagcctgggcagcgggccgccgctccgcactgcccagtacaac
tccaagtggctcaatgagccaaacttcgtggcagcttatgacatcgggctgtttgcctac
ttcttcctgcgggagaacgcagtggagcacgactgtgggcgcacggtgtactcgcgcgtg
gcgcgcgtgtgcaagaacgacgtgggcggccgcttcctgctggaggacacgtggaccact
ttcatgaaggcgcggctcaactgctcccgcccgggcgaggtgcccttctactacaacgag
ctgcagagtgccttccacctgcccgagcaggacctcatctatggcgtcttcaccaccaac
gtaaacagcatcgccgcttctgccgtctgcgccttcaacctcagtgccatctctcaggca
ttcaatggcccatttcgctaccaggagaaccccagggctgcctggctccccatcgccaac
cccctccccaacttccagtgcggcaccctgcccgagaccggccccaacgagaacctgacc
gagcgcagcctgcaggacgcgcagcgcctgtttctgatgagcgaggccgtgcaagcggtg
acgcccgagccctgcgttacccaggacagcttaccccagggaccagacacgctctaccac
gtgctctacatcggcaccgagtctggcaccatcctgaaggcgctgtccacggcgagccgc
agcctgcgcggctgctacctggaagaactgcacgtgctgccccccgggcgccgcgagcca
ctgcgcagcctgcgtatcctgcacagcgcacgcgcgctcttcgtggggctgagcgagggc
gtgctgcgcgtgccgctcgagaggtgcgccgcctaccgcagccagggggcgtgtctgggg
gcgcgagacccatactgtggctgggacgggaagcagcaacgttgtagcacgcttgaagac
agttccaacatgagcctctggacccagaacatcacagcgtgtcctgtgcggaatgtgacc
cgggatggaggctttggcccatggtcaccatggcaaccatgtgagcacttagatggggac
aactccggctcttgcctgtgtcgggcacgatcctgtgactccccacaacctcgctgtggg
ggccttggctgcctggggccagccatccacatcgccaactgctccaggaatggggcgtgg
acgccatggtcatcctgggcgcagtgcagcacgtcctgtggcatcggcttccaggtccgc
cagcggagttgcagcaaccctgccccccgccacgggggccgcatctgcgtgggcaagagc
cgtgaggagcggttctgtaacgaacacacgccctgcccggtgcccatcttctgggcctcg
tggggctcatggagcaagtgcagcagcgactgcgggggcggcgtgcagtcccggcggcgg
gcctgcgagaacggcgactcctgcccgggctgcggcgtggagttcaagacgtgcaacccc
gacggctgccccgaggtgcggcgcaacacgccctggacgccctggctgcccgtgaacgtg
acgccgggcggggcgcggcaggagcagcgcttccgcttcacctgccgcgcgcccctgccg
gacccgcacggcctgcagctgggcaggaggaggacggagacaagaacgtgccccgcggac
ggctccggagcctgcgacacggacgccctggtggaggacctcttgcgcagtgggaacgtt
ggcccgcacgcgctgagcgggggctgggcgccctggggcccgtggtcatcctgctcccgg
gactgcgagctgggcttccgcgttcgcaagaggacctgcacgaaccccgagccgcgcgct
ggaggtctgccgtgcgtgggcgacgccgccgagtaccaggactgcaaccctcaggcgtgc
ccagtccggggagcctggtcctgctggacctcgtggtccccatgctcagcctcctgtggc
gggggccactaccagcgcactcgctcctgcaccagccccgcgccctctcctggcgaggac
gtctgtctcgggctgcacacggaagaggcgctgtgtgccacgcaggcctgcccagaaggc
tggtcgccatggtccgagtggggtgcgtgcgctgaggatggagcccagagccgcagccgg
cactgtgaggagctggcaccggggcccggtacctgtgctgggaacagcagtcagagccgc
ccctgcccctacggcgagattcctgtgatcctgcctgcctccagcatggaggaggccacc
agctgtgcagggttcagtctcatccacctggtggtcaccggtgtctcctgcttcctgggc
tccgggctcttgaccttggctgtgtacctgtcctgccagcactgccaacgccagtcccag
gagtccacacttgtccatcccgccacccccaaccacctgcactacaagggtgggggcacc
cctaagaacgagaagtacacacccatggagttcaagaccctgaacaagaataatttgatc
cccgatgacagagccaacttctacccattgcaacagaccaatgtgtacacaaccacctac
tacccaagcccgctgaacaaacacagcttccgacccgaagcctcacctggacaacggtgc
tttcccaacagctga

DBGET integrated database retrieval system