KEGG   Oryctolagus cuniculus (rabbit): 100340823
Entry
100340823         CDS       T03373                                 
Symbol
UBE2W
Name
(RefSeq) ubiquitin conjugating enzyme E2 W
  KO
K10688  ubiquitin-conjugating enzyme E2 W [EC:2.3.2.25]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100340823 (UBE2W)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100340823 (UBE2W)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.25  N-terminal E2 ubiquitin-conjugating enzyme
     100340823 (UBE2W)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100340823 (UBE2W)
SSDB
Motif
Pfam: UQ_con UEV Prok-E2_B Prok-E2_A
Other DBs
NCBI-GeneID: 100340823
NCBI-ProteinID: XP_002710685
LinkDB
Position
3:complement(89595552..89665227)
AA seq 151 aa
MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKF
SSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCK
EKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcgtcaatgcagaaacgactacagaaagaactgttggctttgcaaaatgacccgcct
ccagggatgactttaaatgaaaagagcgttcaaaattcaattacacagtggattgtagac
atggagggtgcaccaggtaccttatatgaaggggaaaaatttcaacttctatttaaattt
agtagtcgatatccttttgactctcctcaggtcatgtttactggtgaaaatattcctgtt
catcctcatgtttatagcaatggtcatatctgtttatccattctaacagaagactggtcc
ccagcgctctcagtccagtcagtttgtcttagcattattagtatgctttccagctgcaaa
gaaaagagacgaccaccagataattctttttatgtgcgaacatgtaacaagaatccaaag
aaaacaaaatggtggtatcatgatgatacttgttga

KEGG   Oryctolagus cuniculus (rabbit): 103347952
Entry
103347952         CDS       T03373                                 
Name
(RefSeq) ubiquitin-conjugating enzyme E2 W
  KO
K10688  ubiquitin-conjugating enzyme E2 W [EC:2.3.2.25]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103347952
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    103347952
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.25  N-terminal E2 ubiquitin-conjugating enzyme
     103347952
Ubiquitin system [BR:ocu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   103347952
SSDB
Motif
Pfam: UQ_con UEV Prok-E2_B Prok-E2_A
Other DBs
NCBI-GeneID: 103347952
NCBI-ProteinID: XP_017196725
LinkDB
Position
3:complement(42948521..42950161)
AA seq 151 aa
MASMQKRLQKELLALQNDPPPGMTLNEKSVQNSITQWIVDMEGAPGTLYEGEKFQLLFKF
SSRYPFDSPQVMFTGENIPVHPHVYSNGHICLSILTEDWSPALSVQSVCLSIISMLSSCK
EKRRPPDNSFYVRTCNKNPKKTKWWYHDDTC
NT seq 456 nt   +upstreamnt  +downstreamnt
atggcgtcaatgcagaaacgactacagaaagaactgttggctttgcaaaatgacccgcct
ccagggatgactttaaatgaaaagagcgttcaaaattcaattacacagtggattgtagac
atggagggtgcaccaggtaccttatatgaaggggaaaaatttcaacttctatttaaattt
agtagtcgatatccttttgactctcctcaggtcatgtttactggtgaaaatattcctgtt
catcctcatgtttatagcaatggtcatatctgtttatccattctaacagaagactggtcc
ccagcgctctcagtccagtcagtttgtcttagcattattagtatgctttccagctgcaaa
gaaaagagacgaccaccagataattctttttatgtgcgaacatgtaacaagaatccaaag
aaaacaaaatggtggtatcatgatgatacttgttga

DBGET integrated database retrieval system