Oryctolagus cuniculus (rabbit): 100341050 Help Entry 100341050         CDS       T03373                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100341050  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100341050  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100341050   09162 Cancer: specific types    05210 Colorectal cancer     100341050    05222 Small cell lung cancer     100341050   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100341050    05161 Hepatitis B     100341050    05160 Hepatitis C     100341050    05164 Influenza A     100341050    05162 Measles     100341050    05163 Human cytomegalovirus infection     100341050    05167 Kaposi sarcoma-associated herpesvirus infection     100341050    05169 Epstein-Barr virus infection     100341050   09171 Infectious disease: bacterial    05134 Legionellosis     100341050    05152 Tuberculosis     100341050   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100341050   09164 Neurodegenerative disease    05010 Alzheimer disease     100341050    05012 Parkinson disease     100341050    05014 Amyotrophic lateral sclerosis     100341050    05016 Huntington disease     100341050    05017 Spinocerebellar ataxia     100341050    05020 Prion disease     100341050    05022 Pathways of neurodegeneration - multiple diseases     100341050   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100341050    05416 Viral myocarditis     100341050   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100341050   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100341050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Tll0287-like Motif Other DBs NCBI-GeneID:  100341050 NCBI-ProteinID:  XP_017205526 Ensembl:  ENSOCUG00000021237 UniProt:  G1TUQ7 LinkDB All DBs Position 1:complement(9822310..9823443) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGWKTGQAVGFSCTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERSDLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggtggaag acaggtcaggccgttggattctcctgcacagacgccaacaagaacaaaggcatcacctgg ggagaggacactctgatggagtatttggagaatcccaaaaaatacatccctggaaccaaa atgatcttcgctggcattaagaagaagaatgaaaggtcagacttgatagcttatctcaaa aaagctacgaatgagtaa

Oryctolagus cuniculus (rabbit): 100341175 Help Entry 100341175         CDS       T03373                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100341175  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100341175  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100341175   09162 Cancer: specific types    05210 Colorectal cancer     100341175    05222 Small cell lung cancer     100341175   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100341175    05161 Hepatitis B     100341175    05160 Hepatitis C     100341175    05164 Influenza A     100341175    05162 Measles     100341175    05163 Human cytomegalovirus infection     100341175    05167 Kaposi sarcoma-associated herpesvirus infection     100341175    05169 Epstein-Barr virus infection     100341175   09171 Infectious disease: bacterial    05134 Legionellosis     100341175    05152 Tuberculosis     100341175   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100341175   09164 Neurodegenerative disease    05010 Alzheimer disease     100341175    05012 Parkinson disease     100341175    05014 Amyotrophic lateral sclerosis     100341175    05016 Huntington disease     100341175    05017 Spinocerebellar ataxia     100341175    05020 Prion disease     100341175    05022 Pathways of neurodegeneration - multiple diseases     100341175   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100341175    05416 Viral myocarditis     100341175   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100341175   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100341175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100341175 NCBI-ProteinID:  XP_002713768 Ensembl:  ENSOCUG00000025605 UniProt:  G1U0B4 LinkDB All DBs Position 10:complement(7051993..7054420) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

Oryctolagus cuniculus (rabbit): 100341515 Help Entry 100341515         CDS       T03373                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100341515  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100341515  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100341515   09162 Cancer: specific types    05210 Colorectal cancer     100341515    05222 Small cell lung cancer     100341515   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100341515    05161 Hepatitis B     100341515    05160 Hepatitis C     100341515    05164 Influenza A     100341515    05162 Measles     100341515    05163 Human cytomegalovirus infection     100341515    05167 Kaposi sarcoma-associated herpesvirus infection     100341515    05169 Epstein-Barr virus infection     100341515   09171 Infectious disease: bacterial    05134 Legionellosis     100341515    05152 Tuberculosis     100341515   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100341515   09164 Neurodegenerative disease    05010 Alzheimer disease     100341515    05012 Parkinson disease     100341515    05014 Amyotrophic lateral sclerosis     100341515    05016 Huntington disease     100341515    05017 Spinocerebellar ataxia     100341515    05020 Prion disease     100341515    05022 Pathways of neurodegeneration - multiple diseases     100341515   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100341515    05416 Viral myocarditis     100341515   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100341515   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100341515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100341515 NCBI-ProteinID:  XP_008255089 Ensembl:  ENSOCUG00000027442 UniProt:  G1TKY2 LinkDB All DBs Position 4:74312100..74312482 Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSHTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKAMNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag acaggtcaggccgttggattctcccacacagacgccaacaagaacaaaggcatcacctgg ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctaaaa aaagctatgaatgagtaa

Oryctolagus cuniculus (rabbit): 100351037 Help Entry 100351037         CDS       T03373                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100351037  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100351037  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100351037   09162 Cancer: specific types    05210 Colorectal cancer     100351037    05222 Small cell lung cancer     100351037   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100351037    05161 Hepatitis B     100351037    05160 Hepatitis C     100351037    05164 Influenza A     100351037    05162 Measles     100351037    05163 Human cytomegalovirus infection     100351037    05167 Kaposi sarcoma-associated herpesvirus infection     100351037    05169 Epstein-Barr virus infection     100351037   09171 Infectious disease: bacterial    05134 Legionellosis     100351037    05152 Tuberculosis     100351037   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100351037   09164 Neurodegenerative disease    05010 Alzheimer disease     100351037    05012 Parkinson disease     100351037    05014 Amyotrophic lateral sclerosis     100351037    05016 Huntington disease     100351037    05017 Spinocerebellar ataxia     100351037    05020 Prion disease     100351037    05022 Pathways of neurodegeneration - multiple diseases     100351037   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100351037    05416 Viral myocarditis     100351037   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100351037   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100351037 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100351037 NCBI-ProteinID:  XP_008271136 LinkDB All DBs Position X:complement(65882419..65883301) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAFGFSYTDAHKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIMKKNERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag acaggtcaggcctttggattctcctacacagacgcccacaagaacaaaggcatcacctgg ggagaggacactctgatggagtatttggagaatcccaagaagtacatccctggaaccaaa atgatcttcgctggcattatgaagaagaatgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

Oryctolagus cuniculus (rabbit): 100353673 Help Entry 100353673         CDS       T03373                                  Name (RefSeq) cytochrome c, testis-specific isoform X1   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100353673  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100353673  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100353673   09162 Cancer: specific types    05210 Colorectal cancer     100353673    05222 Small cell lung cancer     100353673   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100353673    05161 Hepatitis B     100353673    05160 Hepatitis C     100353673    05164 Influenza A     100353673    05162 Measles     100353673    05163 Human cytomegalovirus infection     100353673    05167 Kaposi sarcoma-associated herpesvirus infection     100353673    05169 Epstein-Barr virus infection     100353673   09171 Infectious disease: bacterial    05134 Legionellosis     100353673    05152 Tuberculosis     100353673   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100353673   09164 Neurodegenerative disease    05010 Alzheimer disease     100353673    05012 Parkinson disease     100353673    05014 Amyotrophic lateral sclerosis     100353673    05016 Huntington disease     100353673    05017 Spinocerebellar ataxia     100353673    05020 Prion disease     100353673    05022 Pathways of neurodegeneration - multiple diseases     100353673   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100353673    05416 Viral myocarditis     100353673   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100353673   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100353673 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Motif Other DBs NCBI-GeneID:  100353673 NCBI-ProteinID:  XP_002712354 Ensembl:  ENSOCUG00000025342 UniProt:  G1TTC7 LinkDB All DBs Position 7:55807025..55819538 Genome browser AA seq 153 aa AA seqDB search MADQTCECHRGPAAEPPPSNSGRGLPPGRGTGEEESRATGPVVPLQSKMGDAETGKKIFI QKCAQCHTVEKGGKHKTGPNLWGLFGRKTGQAQGFSYSDANKNKGIVWGEDTLMEYLENP KKYIPGTKMVFAGLKKKTEREDLIQYLKQATSS NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctgaccagacctgcgagtgtcatcgaggccctgctgcagaaccaccaccatcgaac tcggggcgcggactcccgcctggccgcggcacaggggaggaggagagcagagctactggc cctgtggttcctctgcagagcaaaatgggagatgctgaaacaggcaagaagatctttatt cagaaatgtgctcagtgccacacagtagaaaaaggtggaaaacacaagactggtccaaat ctctggggtctctttggccgaaaaacaggacaagcacaaggattctcttattctgatgca aacaaaaacaaaggtattgtctggggagaagatactctgatggaatatttggagaaccca aagaaatatatccctggaactaaaatggtctttgctggtcttaaaaagaagactgagaga gaagatcttattcaatatttgaaacaggccacgtcttcatga

Oryctolagus cuniculus (rabbit): 100354468 Help Entry 100354468         CDS       T03373                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100354468  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100354468  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100354468   09162 Cancer: specific types    05210 Colorectal cancer     100354468    05222 Small cell lung cancer     100354468   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100354468    05161 Hepatitis B     100354468    05160 Hepatitis C     100354468    05164 Influenza A     100354468    05162 Measles     100354468    05163 Human cytomegalovirus infection     100354468    05167 Kaposi sarcoma-associated herpesvirus infection     100354468    05169 Epstein-Barr virus infection     100354468   09171 Infectious disease: bacterial    05134 Legionellosis     100354468    05152 Tuberculosis     100354468   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100354468   09164 Neurodegenerative disease    05010 Alzheimer disease     100354468    05012 Parkinson disease     100354468    05014 Amyotrophic lateral sclerosis     100354468    05016 Huntington disease     100354468    05017 Spinocerebellar ataxia     100354468    05020 Prion disease     100354468    05022 Pathways of neurodegeneration - multiple diseases     100354468   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100354468    05416 Viral myocarditis     100354468   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100354468   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100354468 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100354468 NCBI-ProteinID:  XP_008269975 Ensembl:  ENSOCUG00000027438 UniProt:  G1TFS7 LinkDB All DBs Position 19:50414124..50414957 Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKAFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAIGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaaggcttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag acaggtcaggccattgggttctcctacacagacgccaacaagaacaaaggcatcacctgg ggagaggacactctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

Oryctolagus cuniculus (rabbit): 100354724 Help Entry 100354724         CDS       T03373                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100354724  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100354724  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100354724   09162 Cancer: specific types    05210 Colorectal cancer     100354724    05222 Small cell lung cancer     100354724   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100354724    05161 Hepatitis B     100354724    05160 Hepatitis C     100354724    05164 Influenza A     100354724    05162 Measles     100354724    05163 Human cytomegalovirus infection     100354724    05167 Kaposi sarcoma-associated herpesvirus infection     100354724    05169 Epstein-Barr virus infection     100354724   09171 Infectious disease: bacterial    05134 Legionellosis     100354724    05152 Tuberculosis     100354724   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100354724   09164 Neurodegenerative disease    05010 Alzheimer disease     100354724    05012 Parkinson disease     100354724    05014 Amyotrophic lateral sclerosis     100354724    05016 Huntington disease     100354724    05017 Spinocerebellar ataxia     100354724    05020 Prion disease     100354724    05022 Pathways of neurodegeneration - multiple diseases     100354724   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100354724    05416 Viral myocarditis     100354724   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100354724   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100354724 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100354724 NCBI-ProteinID:  XP_002719667 LinkDB All DBs Position 20:complement(27249613..27250573) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKTERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa atgatcttcgctggcattaagaagaagactgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

Oryctolagus cuniculus (rabbit): 100355084 Help Entry 100355084         CDS       T03373                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100355084  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100355084  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100355084   09162 Cancer: specific types    05210 Colorectal cancer     100355084    05222 Small cell lung cancer     100355084   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100355084    05161 Hepatitis B     100355084    05160 Hepatitis C     100355084    05164 Influenza A     100355084    05162 Measles     100355084    05163 Human cytomegalovirus infection     100355084    05167 Kaposi sarcoma-associated herpesvirus infection     100355084    05169 Epstein-Barr virus infection     100355084   09171 Infectious disease: bacterial    05134 Legionellosis     100355084    05152 Tuberculosis     100355084   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100355084   09164 Neurodegenerative disease    05010 Alzheimer disease     100355084    05012 Parkinson disease     100355084    05014 Amyotrophic lateral sclerosis     100355084    05016 Huntington disease     100355084    05017 Spinocerebellar ataxia     100355084    05020 Prion disease     100355084    05022 Pathways of neurodegeneration - multiple diseases     100355084   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100355084    05416 Viral myocarditis     100355084   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100355084   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100355084 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100355084 NCBI-ProteinID:  XP_017205665 Ensembl:  ENSOCUG00000028125 UniProt:  G1U0B4 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaagggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgttcgggcggaag acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

Oryctolagus cuniculus (rabbit): 100357329 Help Entry 100357329         CDS       T03373                                  Name (RefSeq) cytochrome c   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100357329  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100357329  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100357329   09162 Cancer: specific types    05210 Colorectal cancer     100357329    05222 Small cell lung cancer     100357329   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100357329    05161 Hepatitis B     100357329    05160 Hepatitis C     100357329    05164 Influenza A     100357329    05162 Measles     100357329    05163 Human cytomegalovirus infection     100357329    05167 Kaposi sarcoma-associated herpesvirus infection     100357329    05169 Epstein-Barr virus infection     100357329   09171 Infectious disease: bacterial    05134 Legionellosis     100357329    05152 Tuberculosis     100357329   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100357329   09164 Neurodegenerative disease    05010 Alzheimer disease     100357329    05012 Parkinson disease     100357329    05014 Amyotrophic lateral sclerosis     100357329    05016 Huntington disease     100357329    05017 Spinocerebellar ataxia     100357329    05020 Prion disease     100357329    05022 Pathways of neurodegeneration - multiple diseases     100357329   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100357329    05416 Viral myocarditis     100357329   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100357329   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100357329 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100357329 NCBI-ProteinID:  XP_008261669 UniProt:  G1U0B4 LinkDB All DBs Position 12:complement(44296372..44297278) Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKMIFAGIKKKNERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgagaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactggaccaaatctccatggtctgtttgggcggaag acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa atgatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

Oryctolagus cuniculus (rabbit): 100357840 Help Entry 100357840         CDS       T03373                                  Name (RefSeq) cytochrome c-like   KO K08738   cytochrome c Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu00190   Oxidative phosphorylation ocu01100   Metabolic pathways ocu01524   Platinum drug resistance ocu04115   p53 signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04932   Non-alcoholic fatty liver disease ocu05010   Alzheimer disease ocu05012   Parkinson disease ocu05014   Amyotrophic lateral sclerosis ocu05016   Huntington disease ocu05017   Spinocerebellar ataxia ocu05020   Prion disease ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05134   Legionellosis ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05160   Hepatitis C ocu05161   Hepatitis B ocu05162   Measles ocu05163   Human cytomegalovirus infection ocu05164   Influenza A ocu05167   Kaposi sarcoma-associated herpesvirus infection ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05210   Colorectal cancer ocu05222   Small cell lung cancer ocu05416   Viral myocarditis ocu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     100357840  09140 Cellular Processes   09143 Cell growth and death    04215 Apoptosis - multiple species     100357840  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100357840   09162 Cancer: specific types    05210 Colorectal cancer     100357840    05222 Small cell lung cancer     100357840   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100357840    05161 Hepatitis B     100357840    05160 Hepatitis C     100357840    05164 Influenza A     100357840    05162 Measles     100357840    05163 Human cytomegalovirus infection     100357840    05167 Kaposi sarcoma-associated herpesvirus infection     100357840    05169 Epstein-Barr virus infection     100357840   09171 Infectious disease: bacterial    05134 Legionellosis     100357840    05152 Tuberculosis     100357840   09174 Infectious disease: parasitic    05145 Toxoplasmosis     100357840   09164 Neurodegenerative disease    05010 Alzheimer disease     100357840    05012 Parkinson disease     100357840    05014 Amyotrophic lateral sclerosis     100357840    05016 Huntington disease     100357840    05017 Spinocerebellar ataxia     100357840    05020 Prion disease     100357840    05022 Pathways of neurodegeneration - multiple diseases     100357840   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100357840    05416 Viral myocarditis     100357840   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100357840   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     100357840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG Motif Other DBs NCBI-GeneID:  100357840 NCBI-ProteinID:  XP_008260510 Ensembl:  ENSOCUG00000027381 UniProt:  G1TY21 LinkDB All DBs Position 11:7364467..7365385 Genome browser AA seq 105 aa AA seqDB search MGDVEKGKKIFVQKCAQCHTVEKGGKHKTEPNLHGLFGRKTGQAVGFSYTDANKNKGITW GEDTLMEYLENPKKYIPGTKRIFAGIKKKNERADLIAYLKKATNE NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgggtgatgttgaaaaaggcaagaagatttttgttcagaaatgtgcccagtgccacact gtggaaaagggaggcaagcacaagactgaaccaaatctccatggtctgttcgggcggaag acaggtcaggccgttggattctcctacacagacgccaacaagaacaaaggcatcacctgg ggagaggacacgctgatggagtatttggagaatcccaagaaatacatccctggaaccaaa aggatcttcgctggcattaagaagaagaatgaaagggcagacttgatagcttatctcaaa aaagctacgaatgagtaa

DBGET integrated database retrieval system